Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fc gamma RIIA/CD32a, Human (HEK293, His)

Fc gamma The RIIA/CD32a protein plays a key role as a low-affinity receptor that specifically binds to the Fc region of immunoglobulin gamma. It interacts with IgG to initiate cellular responses against pathogens, which is critical for immune regulation. Fc gamma RIIA/CD32a Protein, Human (HEK293, His) is the recombinant human-derived Fc gamma RIIA/CD32a protein, expressed by HEK293 , with C-6*His labeled tag and H167, , , , mutation.

Product Specifications

Product Name Alternative

Fc gamma RIIA/CD32a Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd32a-protein-human-hek-293-his.html

Purity

98.0

Smiles

AAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGI

Molecular Formula

2212 (Gene_ID) P12318-1 (A36-I218, H167) (Accession)

Molecular Weight

25-34 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti Heparan Sulfate Pab
165415 100 µg

Anti Heparan Sulfate Pab

Sign In for Pricing
View Details
Nogo Rabbit monoclonal antibody
BS40714-01 50 µL

Nogo Rabbit monoclonal antibody

Sign In for Pricing
View Details
Nogo Rabbit monoclonal antibody
BS40714-02 100 µL

Nogo Rabbit monoclonal antibody

Sign In for Pricing
View Details
Rabbit Follistatin Like Protein 1 (FSTL-1) ELISA Kit
YP-W102102-01 48 Tests

Rabbit Follistatin Like Protein 1 (FSTL-1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Follistatin Like Protein 1 (FSTL-1) ELISA Kit
YP-W102102-02 96 Tests

Rabbit Follistatin Like Protein 1 (FSTL-1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal MMP-24/MT5-MMP Antibody
NBP3-17274-25ul 25 µL

Rabbit Polyclonal MMP-24/MT5-MMP Antibody

Sign In for Pricing
View Details