Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free BMP-8b, Human (His)

BMP-8 is a pleiotropic ligand protein act as a reproductive system regulator, enriched in the ovary. BMP-8 is encoded by a pair of genes BMP8A and BMP8B, belonging to TNF-β family[1]. BMP-8B is secreted by brown/beige adipocytes and enhances energy dissipation, serves as a potential targets in obesity[2]. BMP-8B also caspase-3 and -9 activation in pancreatic cancer cell, as well as decreasing mitochondrial membrane potential to induce apoptosis[3]. BMP-8b Protein, Human is 402 a.a. with 2 glycosylation domains. Animal-Free BMP-8a Protein, Human (His) is a animal free recombinant human protein produced in E. coli cells, with 139 a.a. (A264-H402) and N-terminal His-tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free BMP-8b Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-bmp-8b-protein-human-his.html

Purity

98.0

Smiles

AVRPLRRRQPKKSNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMMPDAVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGCH

Molecular Formula

656 (Gene_ID) P34820 (A264-H402) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Wu FJ, et al. Human BMP8A suppresses luteinization of rat granulosa cells via the SMAD1/5/8 pathway. Reproduction. 2020 Mar;159 (3) :315-324.|[2]Pellegrinelli V, et al. Adipocyte-secreted BMP8b mediates adrenergic-induced remodeling of the neuro-vascular network in adipose tissue. Nat Commun. 2018 Nov 26;9 (1) :4974.|[3]Cheng Z, et al. BMP8B mediates the survival of pancreatic cancer cells and regulates the progression of pancreatic cancer. Oncol Rep. 2014 Nov;32 (5) :1861-6.|[4]Yu YP, et al. BMP8A promotes survival and drug resistance via Nrf2/TRIM24 signaling pathway in clear cell renal cell carcinoma. Cancer Sci. 2020 May;111 (5) :1555-1566.|[5]Whittle AJ, et al. BMP8B increases brown adipose tissue thermogenesis through both central and peripheral actions. Cell. 2012 May 11;149 (4) :871-85.|[6]Ohinata Y, et al. A signaling principle for the specification of the germ cell lineage in mice. Cell. 2009 May 1;137 (3) :571-84.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC100045864 3'UTR GFP Stable Cell Line
TU161460 1.0 mL

LOC100045864 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Mouse Monoclonal TIM-3 Antibody (TIM3/3113) [PE]
NBP2-79836PE 0.1 mL

Mouse Monoclonal TIM-3 Antibody (TIM3/3113) [PE]

Sign In for Pricing
View Details
WDR25 (NM_024515) Human Tagged ORF Clone Lentiviral Particle
RC216049L2V 200 µL

WDR25 (NM_024515) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Capping Protein (Actin Filament) Muscle Z-Line, Alpha 1 (CAPZA1) Antibody
abx111358 100 µL

Capping Protein (Actin Filament) Muscle Z-Line, Alpha 1 (CAPZA1) Antibody

Sign In for Pricing
View Details
Lentiviral mouse Terf1 shRNA (UAS) - Lentiviral mouse Terf1 shRNA (UAS) plasmid
GTR15216163 1 Vial

Lentiviral mouse Terf1 shRNA (UAS) - Lentiviral mouse Terf1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
PR48 discontinued
541275-01 30ul

PR48 discontinued

Sign In for Pricing
View Details