Animal-Free BMP-8b, Human (His)

BMP-8 is a pleiotropic ligand protein act as a reproductive system regulator, enriched in the ovary. BMP-8 is encoded by a pair of genes BMP8A and BMP8B, belonging to TNF-β family[1]. BMP-8B is secreted by brown/beige adipocytes and enhances energy dissipation, serves as a potential targets in obesity[2]. BMP-8B also caspase-3 and -9 activation in pancreatic cancer cell, as well as decreasing mitochondrial membrane potential to induce apoptosis[3]. BMP-8b Protein, Human is 402 a.a. with 2 glycosylation domains. Animal-Free BMP-8a Protein, Human (His) is a animal free recombinant human protein produced in E. coli cells, with 139 a.a. (A264-H402) and N-terminal His-tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free BMP-8b Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-bmp-8b-protein-human-his.html

Purity

98.0

Smiles

AVRPLRRRQPKKSNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMMPDAVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGCH

Molecular Formula

656 (Gene_ID) P34820 (A264-H402) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Wu FJ, et al. Human BMP8A suppresses luteinization of rat granulosa cells via the SMAD1/5/8 pathway. Reproduction. 2020 Mar;159 (3) :315-324.|[2]Pellegrinelli V, et al. Adipocyte-secreted BMP8b mediates adrenergic-induced remodeling of the neuro-vascular network in adipose tissue. Nat Commun. 2018 Nov 26;9 (1) :4974.|[3]Cheng Z, et al. BMP8B mediates the survival of pancreatic cancer cells and regulates the progression of pancreatic cancer. Oncol Rep. 2014 Nov;32 (5) :1861-6.|[4]Yu YP, et al. BMP8A promotes survival and drug resistance via Nrf2/TRIM24 signaling pathway in clear cell renal cell carcinoma. Cancer Sci. 2020 May;111 (5) :1555-1566.|[5]Whittle AJ, et al. BMP8B increases brown adipose tissue thermogenesis through both central and peripheral actions. Cell. 2012 May 11;149 (4) :871-85.|[6]Ohinata Y, et al. A signaling principle for the specification of the germ cell lineage in mice. Cell. 2009 May 1;137 (3) :571-84.