Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Thioredoxin/TXN, Human (His)

Thioredoxin/TXN Protein, Human (His) is a thiol-oxidoreductase enzyme which control cellular redox homeostasis.

Product Specifications

Product Name Alternative

Thioredoxin/TXN Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/thioredoxin-txn-protein-human-his.html

Purity

99.38

Smiles

VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Molecular Formula

7295 (Gene_ID) P10599 (V2-V105) (Accession)

Molecular Weight

Approximately 13 kDa

References & Citations

[1]Léveillard T, et al. Cell Signaling with Extracellular Thioredoxin and Thioredoxin-Like Proteins: Insight into Their Mechanisms of Action. Oxid Med Cell Longev. 2017;2017:8475125.|[2]Roesner LM, et al. Human thioredoxin, a damage-associated molecular pattern and Malassezia-crossreactive autoallergen, modulates immune responses via the C-type lectin receptors Dectin-1 and Dectin-2. Sci Rep. 2019 Aug 1;9 (1) :11210.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CBL Rabbit Polyclonal Antibody
AP06426PU-N 100 µg

CBL Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Slc17a7 Mouse Monoclonal Antibody [Clone ID: N28/9]
75-066 100 µL

Slc17a7 Mouse Monoclonal Antibody [Clone ID: N28/9]

Sign In for Pricing
View Details
OXGR1 Rabbit Monoclonal Antibody [Clone ID: 23GB4575]
TA425028 100 µL

OXGR1 Rabbit Monoclonal Antibody [Clone ID: 23GB4575]

Sign In for Pricing
View Details
Alpha Taxilin (TXLNA) Rabbit Polyclonal Antibody
TA382952 100 µL

Alpha Taxilin (TXLNA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Stomach
CS807960 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
Cytokeratin 7 (OV-TL12/30), CF568 conjugate, 0.1mg/mL
BNC680683-100 1x 100 µL

Cytokeratin 7 (OV-TL12/30), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details