Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Thioredoxin/TXN, Human (His)

Thioredoxin/TXN Protein, Human (His) is a thiol-oxidoreductase enzyme which control cellular redox homeostasis.

Product Specifications

Product Name Alternative

Thioredoxin/TXN Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/thioredoxin-txn-protein-human-his.html

Purity

99.38

Smiles

VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Molecular Formula

7295 (Gene_ID) P10599 (V2-V105) (Accession)

Molecular Weight

Approximately 13 kDa

References & Citations

[1]Léveillard T, et al. Cell Signaling with Extracellular Thioredoxin and Thioredoxin-Like Proteins: Insight into Their Mechanisms of Action. Oxid Med Cell Longev. 2017;2017:8475125.|[2]Roesner LM, et al. Human thioredoxin, a damage-associated molecular pattern and Malassezia-crossreactive autoallergen, modulates immune responses via the C-type lectin receptors Dectin-1 and Dectin-2. Sci Rep. 2019 Aug 1;9 (1) :11210.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR135B Human qPCR Primer Pair (MI0000810)
HP300148 200 Reactions

MIR135B Human qPCR Primer Pair (MI0000810)

Sign In for Pricing
View Details
Progesterone Receptor (PGR) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G7]
TA800729AM 100 µL

Progesterone Receptor (PGR) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G7]

Sign In for Pricing
View Details
Acarviosin
TRC-A123550-25MG 25 mg

Acarviosin

Sign In for Pricing
View Details
Human SRGAP2C activation kit by CRISPRa
GA118843 1 Kit

Human SRGAP2C activation kit by CRISPRa

Sign In for Pricing
View Details
KHDC1L (NM_001126063) Human Over-expression Lysate
LC426643 20 µg

KHDC1L (NM_001126063) Human Over-expression Lysate

Sign In for Pricing
View Details
TGF beta 3 (TGFB3) Rabbit Polyclonal Antibody
TA382473 100 µL

TGF beta 3 (TGFB3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details