Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Thioredoxin/TXN, Human (His)

Thioredoxin/TXN Protein, Human (His) is a thiol-oxidoreductase enzyme which control cellular redox homeostasis.

Product Specifications

Product Name Alternative

Thioredoxin/TXN Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/thioredoxin-txn-protein-human-his.html

Purity

99.38

Smiles

VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Molecular Formula

7295 (Gene_ID) P10599 (V2-V105) (Accession)

Molecular Weight

Approximately 13 kDa

References & Citations

[1]Léveillard T, et al. Cell Signaling with Extracellular Thioredoxin and Thioredoxin-Like Proteins: Insight into Their Mechanisms of Action. Oxid Med Cell Longev. 2017;2017:8475125.|[2]Roesner LM, et al. Human thioredoxin, a damage-associated molecular pattern and Malassezia-crossreactive autoallergen, modulates immune responses via the C-type lectin receptors Dectin-1 and Dectin-2. Sci Rep. 2019 Aug 1;9 (1) :11210.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Gfpt2 activation kit by CRISPRa
GA201594 1 Kit

Mouse Gfpt2 activation kit by CRISPRa

Sign In for Pricing
View Details
GDNF Receptor alpha 2 (GFRA2) (NM_001165038) Human Over-expression Lysate
LC431318 20 µg

GDNF Receptor alpha 2 (GFRA2) (NM_001165038) Human Over-expression Lysate

Sign In for Pricing
View Details
2’-Deoxyisoguanosine
TRC-D281570-10MG 10 mg

2’-Deoxyisoguanosine

Sign In for Pricing
View Details
COX8C Human Gene Knockout Kit (CRISPR)
KN419625 1 Kit

COX8C Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Biotin Conjugated Rabbit Affinity Purified Antibody to Mouse IgG,
BAF-541-1 1 mL

Biotin Conjugated Rabbit Affinity Purified Antibody to Mouse IgG,

Sign In for Pricing
View Details
Fas Ligand (FASLG) Mouse Monoclonal Antibody [Clone ID: B-R17]
AM31198AF-N 200 µg

Fas Ligand (FASLG) Mouse Monoclonal Antibody [Clone ID: B-R17]

Sign In for Pricing
View Details