Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Thioredoxin/TXN, Human (His)

Thioredoxin/TXN Protein, Human (His) is a thiol-oxidoreductase enzyme which control cellular redox homeostasis.

Product Specifications

Product Name Alternative

Thioredoxin/TXN Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/thioredoxin-txn-protein-human-his.html

Purity

99.38

Smiles

VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Molecular Formula

7295 (Gene_ID) P10599 (V2-V105) (Accession)

Molecular Weight

Approximately 13 kDa

References & Citations

[1]Léveillard T, et al. Cell Signaling with Extracellular Thioredoxin and Thioredoxin-Like Proteins: Insight into Their Mechanisms of Action. Oxid Med Cell Longev. 2017;2017:8475125.|[2]Roesner LM, et al. Human thioredoxin, a damage-associated molecular pattern and Malassezia-crossreactive autoallergen, modulates immune responses via the C-type lectin receptors Dectin-1 and Dectin-2. Sci Rep. 2019 Aug 1;9 (1) :11210.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACSM1 (NM_052956) Human Over-expression Lysate
LY403276 100 µg

ACSM1 (NM_052956) Human Over-expression Lysate

Sign In for Pricing
View Details
BTN3A1 Rabbit Polyclonal Antibody
TA383836 100 µL

BTN3A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometrium
CS506931 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details
Tissue FFPE Sections, Bone: femur, distal
CS707047 5x 5 µm

Tissue FFPE Sections, Bone: femur, distal

Sign In for Pricing
View Details
BCDIN3D Human Gene Knockout Kit (CRISPR)
KN208818LP 1 Kit

BCDIN3D Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human VCAM-1/CD106 Protein (His Tag)
PDMH100205-01 20 µg

Recombinant Human VCAM-1/CD106 Protein (His Tag)

Sign In for Pricing
View Details