Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Thioredoxin/TXN, Human (His)

Thioredoxin/TXN Protein, Human (His) is a thiol-oxidoreductase enzyme which control cellular redox homeostasis.

Product Specifications

Product Name Alternative

Thioredoxin/TXN Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/thioredoxin-txn-protein-human-his.html

Purity

99.38

Smiles

VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Molecular Formula

7295 (Gene_ID) P10599 (V2-V105) (Accession)

Molecular Weight

Approximately 13 kDa

References & Citations

[1]Léveillard T, et al. Cell Signaling with Extracellular Thioredoxin and Thioredoxin-Like Proteins: Insight into Their Mechanisms of Action. Oxid Med Cell Longev. 2017;2017:8475125.|[2]Roesner LM, et al. Human thioredoxin, a damage-associated molecular pattern and Malassezia-crossreactive autoallergen, modulates immune responses via the C-type lectin receptors Dectin-1 and Dectin-2. Sci Rep. 2019 Aug 1;9 (1) :11210.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL31 Antibody
KC-3933-01 50 μL

IL31 Antibody

Sign In for Pricing
View Details
IL31 Antibody
KC-3933-02 100 µL

IL31 Antibody

Sign In for Pricing
View Details
IL31 Antibody
KC-3933-03 1 mL

IL31 Antibody

Sign In for Pricing
View Details
Cytokeratin 19 (A53-B/A2.26 + BA17), Biotin conjugate, 0.1mg/mL
BNCB0753-500 1x 500 µL

Cytokeratin 19 (A53-B/A2.26 + BA17), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse IgD Antibody[11-26c.2a]
E-AB-F1189UG-01 25 µg

PE/Cyanine5 Anti-Mouse IgD Antibody[11-26c.2a]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse IgD Antibody[11-26c.2a]
E-AB-F1189UG-02 100 µg

PE/Cyanine5 Anti-Mouse IgD Antibody[11-26c.2a]

Sign In for Pricing
View Details