Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Thioredoxin/TXN, Human (His)

Thioredoxin/TXN Protein, Human (His) is a thiol-oxidoreductase enzyme which control cellular redox homeostasis.

Product Specifications

Product Name Alternative

Thioredoxin/TXN Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/thioredoxin-txn-protein-human-his.html

Purity

99.38

Smiles

VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Molecular Formula

7295 (Gene_ID) P10599 (V2-V105) (Accession)

Molecular Weight

Approximately 13 kDa

References & Citations

[1]Léveillard T, et al. Cell Signaling with Extracellular Thioredoxin and Thioredoxin-Like Proteins: Insight into Their Mechanisms of Action. Oxid Med Cell Longev. 2017;2017:8475125.|[2]Roesner LM, et al. Human thioredoxin, a damage-associated molecular pattern and Malassezia-crossreactive autoallergen, modulates immune responses via the C-type lectin receptors Dectin-1 and Dectin-2. Sci Rep. 2019 Aug 1;9 (1) :11210.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human IgA Antibody
KC-072-01 50 μL

Anti-Human IgA Antibody

Sign In for Pricing
View Details
Anti-Human IgA Antibody
KC-072-02 100 µL

Anti-Human IgA Antibody

Sign In for Pricing
View Details
Anti-Human IgA Antibody
KC-072-03 1 mL

Anti-Human IgA Antibody

Sign In for Pricing
View Details
Mucolipin 3 (MCOLN3) (NM_018298) Human Over-expression Lysate
LY402663 100 µg

Mucolipin 3 (MCOLN3) (NM_018298) Human Over-expression Lysate

Sign In for Pricing
View Details
Screen Quest™ Colorimetric ELISA cAMP Assay Kit
36370-AAT 1 Plate

Screen Quest™ Colorimetric ELISA cAMP Assay Kit

Sign In for Pricing
View Details
SYPL1 Human Knockdown Lysate
LY300306 100 µg

SYPL1 Human Knockdown Lysate

Sign In for Pricing
View Details