Activin RIA, Human (HEK293, His-Fc)
Activin A receptor, type I (ACVR1), also known as ALK-2, is a bone morphogenetic protein (BMP) type I receptor. ACVR1 is involved in a wide variety of biological processes, including bone, heart, cartilage, nervous, and reproductive system development and regulation[1]. Activin RIA Protein, Human (HEK293, His-Fc) is produced in HEK293 cells with a C-Terminal His-tag and a C-Terminal Fc-tag . It consists of 124 amino acids (M1-V124) .
Product Specifications
Product Name Alternative
Activin RIA Protein, Human (HEK293, His-Fc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/activin-ria-protein-human-hek293-his-fc.html
Purity
98.0
Smiles
MVDGVMILPVLIMIALPSPSMEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEV
Molecular Formula
90 (Gene_ID) Q04771 (M21-V124) (Accession)
Molecular Weight
45 kDa
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL
IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL
CD59 (heavy chain of Protectin) (BRA-10G), CF594 conjugate, 0.1mg/mL
Eosinophil Peroxidase (AHE-1), CF594 conjugate, 0.1mg/mL
Von Willebrand Factor (3E2D10 + VWF635), CF488A conjugate, 0.1mg/mL
