Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PKA/PRKACA, Canine (His)

PKA/PRKACA Protein, Canine (His) is the recombinant canine-derived PKA/PRKACA protein, expressed by E. coli, with N-His labeled tag.

Product Specifications

Product Name Alternative

PKA/PRKACA Protein, Canine (His), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pka-prkaca-protein-canine-his-solutin.html

Purity

95.0

Smiles

GNAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFCEF

Molecular Formula

403556 (Gene_ID) Q8MJ44/NP_001003032.1 (G2-F350) (Accession)

Molecular Weight

41.51 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTPD1, ID (Tyrosine-protein Phosphatase Non-receptor Type 21, Protein-tyrosine Phosphatase D1, PTPN21)
MBS630244-01 0.2 mL

PTPD1, ID (Tyrosine-protein Phosphatase Non-receptor Type 21, Protein-tyrosine Phosphatase D1, PTPN21)

Sign In for Pricing
View Details
PTPD1, ID (Tyrosine-protein Phosphatase Non-receptor Type 21, Protein-tyrosine Phosphatase D1, PTPN21)
MBS630244-02 5x 0.2 mL

PTPD1, ID (Tyrosine-protein Phosphatase Non-receptor Type 21, Protein-tyrosine Phosphatase D1, PTPN21)

Sign In for Pricing
View Details
DENND1B Protein Vector (Human) (pPM-C-HA)
PV012171 500 ng

DENND1B Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
KLK7 Rabbit pAb
E45R25890N-100 100 µL

KLK7 Rabbit pAb

Sign In for Pricing
View Details
FAIM1, Control Peptide (Fas Apoptotic Inhibitory Molecule 1, FLJ10582, FAIM)
147916 100 µg

FAIM1, Control Peptide (Fas Apoptotic Inhibitory Molecule 1, FLJ10582, FAIM)

Sign In for Pricing
View Details
Svs3b Protein Vector (Rat) (pPB-C-His)
PV309090 500 ng

Svs3b Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details