Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PKA/PRKACA, Canine (His)

PKA/PRKACA Protein, Canine (His) is the recombinant canine-derived PKA/PRKACA protein, expressed by E. coli, with N-His labeled tag.

Product Specifications

Product Name Alternative

PKA/PRKACA Protein, Canine (His), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pka-prkaca-protein-canine-his-solutin.html

Purity

95.0

Smiles

GNAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFCEF

Molecular Formula

403556 (Gene_ID) Q8MJ44/NP_001003032.1 (G2-F350) (Accession)

Molecular Weight

41.51 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CXorf20 (BEND2) (NM_153346) Human Over-expression Lysate
LH14867V 100 µg

CXorf20 (BEND2) (NM_153346) Human Over-expression Lysate

Sign In for Pricing
View Details
Mdivi-1 200mg
A14316-200 200 mg

Mdivi-1 200mg

Sign In for Pricing
View Details
EIF3F Antibody
MBS7125518-01 0.05 mL

EIF3F Antibody

Sign In for Pricing
View Details
EIF3F Antibody
MBS7125518-02 0.1 mL

EIF3F Antibody

Sign In for Pricing
View Details
EIF3F Antibody
MBS7125518-03 5x 0.1 mL

EIF3F Antibody

Sign In for Pricing
View Details
Rabbit anti-FOXP3 Antibody
YLD3181-01 50 µL

Rabbit anti-FOXP3 Antibody

Sign In for Pricing
View Details