Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PKA/PRKACA, Canine (His)

PKA/PRKACA Protein, Canine (His) is the recombinant canine-derived PKA/PRKACA protein, expressed by E. coli, with N-His labeled tag.

Product Specifications

Product Name Alternative

PKA/PRKACA Protein, Canine (His), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pka-prkaca-protein-canine-his-solutin.html

Purity

95.0

Smiles

GNAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFCEF

Molecular Formula

403556 (Gene_ID) Q8MJ44/NP_001003032.1 (G2-F350) (Accession)

Molecular Weight

41.51 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KA1 (GRIK4) (NM_014619) Human Tagged ORF Clone
RG214488 10 µg

KA1 (GRIK4) (NM_014619) Human Tagged ORF Clone

Sign In for Pricing
View Details
DDIT4, CT (DDIT4, REDD1, RTP801, DNA damage-inducible transcript 4 protein, HIF-1 responsive protein RTP801, Protein regulated in development and DNA damage response 1)
034536 200 µL

DDIT4, CT (DDIT4, REDD1, RTP801, DNA damage-inducible transcript 4 protein, HIF-1 responsive protein RTP801, Protein regulated in development and DNA damage response 1)

Sign In for Pricing
View Details
SCO1 (NM_004589) Human Tagged ORF Clone
RG202026 10 µg

SCO1 (NM_004589) Human Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Rassf2 ELISA KIT
ELI-39170m 96 Tests

Mouse Rassf2 ELISA KIT

Sign In for Pricing
View Details
Mouse Odf3l1 ELISA KIT
ELI-23521m 96 Tests

Mouse Odf3l1 ELISA KIT

Sign In for Pricing
View Details
ZNF491 (NM_152356) Human Tagged ORF Clone
RG210948 10 µg

ZNF491 (NM_152356) Human Tagged ORF Clone

Sign In for Pricing
View Details