Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PKA/PRKACA, Canine (His)

PKA/PRKACA Protein, Canine (His) is the recombinant canine-derived PKA/PRKACA protein, expressed by E. coli, with N-His labeled tag.

Product Specifications

Product Name Alternative

PKA/PRKACA Protein, Canine (His), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pka-prkaca-protein-canine-his-solutin.html

Purity

95.0

Smiles

GNAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFCEF

Molecular Formula

403556 (Gene_ID) Q8MJ44/NP_001003032.1 (G2-F350) (Accession)

Molecular Weight

41.51 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OPLAH (NM_017570) Human Over-expression Lysate
LC413711 20 µg

OPLAH (NM_017570) Human Over-expression Lysate

Sign In for Pricing
View Details
LPAR2 Recombinant Protein (Mouse)
RP147929 100 µg

LPAR2 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
FYTTD1 ORF Vector (Human) (pORF)
ORF004241 1.0 µg DNA

FYTTD1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Opicinumab
MBS5819210 Inquire

Opicinumab

Sign In for Pricing
View Details
Human Muscarinic acetylcholine receptor M3 (CHRM3) ELISA Kit
YP-W17324-01 48 Tests

Human Muscarinic acetylcholine receptor M3 (CHRM3) ELISA Kit

Sign In for Pricing
View Details
Human Muscarinic acetylcholine receptor M3 (CHRM3) ELISA Kit
YP-W17324-02 96 Tests

Human Muscarinic acetylcholine receptor M3 (CHRM3) ELISA Kit

Sign In for Pricing
View Details