Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PKA/PRKACA, Canine (His)

PKA/PRKACA Protein, Canine (His) is the recombinant canine-derived PKA/PRKACA protein, expressed by E. coli, with N-His labeled tag.

Product Specifications

Product Name Alternative

PKA/PRKACA Protein, Canine (His), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pka-prkaca-protein-canine-his-solutin.html

Purity

95.0

Smiles

GNAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFCEF

Molecular Formula

403556 (Gene_ID) Q8MJ44/NP_001003032.1 (G2-F350) (Accession)

Molecular Weight

41.51 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aqp11 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4354506 1.0 µg DNA

Aqp11 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Rabbit β Mannosidase (β-Manase) ELISA Kit
EIA05127Rb 1 Kit

Rabbit β Mannosidase (β-Manase) ELISA Kit

Sign In for Pricing
View Details
Antibody against neomycin phosphotransferase type II
MBS478392-01 1 mg

Antibody against neomycin phosphotransferase type II

Sign In for Pricing
View Details
Antibody against neomycin phosphotransferase type II
MBS478392-02 2 mg

Antibody against neomycin phosphotransferase type II

Sign In for Pricing
View Details
Antibody against neomycin phosphotransferase type II
MBS478392-03 5 mg

Antibody against neomycin phosphotransferase type II

Sign In for Pricing
View Details
Antibody against neomycin phosphotransferase type II
MBS478392-04 10 mg

Antibody against neomycin phosphotransferase type II

Sign In for Pricing
View Details