Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PKA/PRKACA, Canine (His)

PKA/PRKACA Protein, Canine (His) is the recombinant canine-derived PKA/PRKACA protein, expressed by E. coli, with N-His labeled tag.

Product Specifications

Product Name Alternative

PKA/PRKACA Protein, Canine (His), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pka-prkaca-protein-canine-his-solutin.html

Purity

95.0

Smiles

GNAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFCEF

Molecular Formula

403556 (Gene_ID) Q8MJ44/NP_001003032.1 (G2-F350) (Accession)

Molecular Weight

41.51 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Znhit6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3627206 1.0 µg DNA

Znhit6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
LMO4 Protein Vector (Mouse) (pPM-C-His)
PV196989 500 ng

LMO4 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
USP46 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
49331066 1.0 µg DNA

USP46 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
PFKL (NM_002626) Human Tagged ORF Clone
RG200922 10 µg

PFKL (NM_002626) Human Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Monoclonal L1CAM Antibody (UJ181.4) [Alexa Fluor 750]
NB100-2683AF750 0.1 mL

Mouse Monoclonal L1CAM Antibody (UJ181.4) [Alexa Fluor 750]

Sign In for Pricing
View Details
Recombinant Human C5AR1, His-tagged
C5AR1-10540H 25 µg

Recombinant Human C5AR1, His-tagged

Sign In for Pricing
View Details