Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PKA/PRKACA, Canine (His)

PKA/PRKACA Protein, Canine (His) is the recombinant canine-derived PKA/PRKACA protein, expressed by E. coli, with N-His labeled tag.

Product Specifications

Product Name Alternative

PKA/PRKACA Protein, Canine (His), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pka-prkaca-protein-canine-his-solutin.html

Purity

95.0

Smiles

GNAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFCEF

Molecular Formula

403556 (Gene_ID) Q8MJ44/NP_001003032.1 (G2-F350) (Accession)

Molecular Weight

41.51 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein FAN (NSMAF) Antibody
abx348644-01 20 µL

Protein FAN (NSMAF) Antibody

Sign In for Pricing
View Details
Protein FAN (NSMAF) Antibody
abx348644-02 50 µL

Protein FAN (NSMAF) Antibody

Sign In for Pricing
View Details
Protein FAN (NSMAF) Antibody
abx348644-03 100 µL

Protein FAN (NSMAF) Antibody

Sign In for Pricing
View Details
Protein FAN (NSMAF) Antibody
abx348644-04 200 µL

Protein FAN (NSMAF) Antibody

Sign In for Pricing
View Details
Protein FAN (NSMAF) Antibody
abx348644-05 1 mL

Protein FAN (NSMAF) Antibody

Sign In for Pricing
View Details
GENLISA Human Mitotic Checkpoint Serine/Threonine-Protein Kinase Bub1 Beta (BUB1B) ELISA
KBH13355 1x 96 Well

GENLISA Human Mitotic Checkpoint Serine/Threonine-Protein Kinase Bub1 Beta (BUB1B) ELISA

Sign In for Pricing
View Details