Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PF-4/CXCL4, Mouse

Platelet factor 4 (PF4) is released during platelet aggregation and neutralizes the anticoagulant effect of heparin with a higher binding affinity than chondroitin 4-sulfate chains. In addition to its anticoagulant effects, PF4 induces neutrophil and monocyte chemotaxis, thereby promoting immune responses. PF-4/CXCL4 Protein, Mouse is the recombinant mouse-derived Platelet factor 4 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

PF-4/CXCL4 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/platelet-factor-4-protein-mouse.html

Purity

97.00

Smiles

VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES

Molecular Formula

56744 (Gene_ID) Q9Z126 (V30-S105) (Accession)

Molecular Weight

Approximately 8.2-12 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CA13 (NM_198584) Human Recombinant Protein
TP720089XL 1 mg

CA13 (NM_198584) Human Recombinant Protein

Sign In for Pricing
View Details
HSP27 (HSPB1) Human Gene Knockout Kit (CRISPR)
KN401800 1 Kit

HSP27 (HSPB1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human SLC25A41 activation kit by CRISPRa
GA117149 1 Kit

Human SLC25A41 activation kit by CRISPRa

Sign In for Pricing
View Details
Bulk Anti-Human CD62L (DREG56) Antibody
ICH1017-100mg 100 mg

Bulk Anti-Human CD62L (DREG56) Antibody

Sign In for Pricing
View Details
1,3-Dioxolane (Stabilized with BHT)
TRC-D486800-500ML 500 mL

1,3-Dioxolane (Stabilized with BHT)

Sign In for Pricing
View Details
CD5 (Mantle Cell Lymphoma Marker) (CD5/2416), CF647 conjugate, 0.1mg/mL
BNC472416-500 1x 500 µL

CD5 (Mantle Cell Lymphoma Marker) (CD5/2416), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details