Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PF-4/CXCL4, Mouse

Platelet factor 4 (PF4) is released during platelet aggregation and neutralizes the anticoagulant effect of heparin with a higher binding affinity than chondroitin 4-sulfate chains. In addition to its anticoagulant effects, PF4 induces neutrophil and monocyte chemotaxis, thereby promoting immune responses. PF-4/CXCL4 Protein, Mouse is the recombinant mouse-derived Platelet factor 4 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

PF-4/CXCL4 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/platelet-factor-4-protein-mouse.html

Purity

97.00

Smiles

VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES

Molecular Formula

56744 (Gene_ID) Q9Z126 (V30-S105) (Accession)

Molecular Weight

Approximately 8.2-12 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NKX1-2 (NM_001146340) Human Over-expression Lysate
LC431272 20 µg

NKX1-2 (NM_001146340) Human Over-expression Lysate

Sign In for Pricing
View Details
4-Deoxy-D-chitobiose Heptaacetate
TRC-D209850-75MG 75 mg

4-Deoxy-D-chitobiose Heptaacetate

Sign In for Pricing
View Details
Progesterone receptor Rabbit Polyclonal Antibody
ER1901-96 100 µL

Progesterone receptor Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DDX3 (DDX3X) Human Gene Knockout Kit (CRISPR)
KN204171RB 1 Kit

DDX3 (DDX3X) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Kallikrein 8 (KLK8) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI13D9]
TA801416AM 100 µL

Kallikrein 8 (KLK8) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI13D9]

Sign In for Pricing
View Details
Tmem129 Mouse Gene Knockout Kit (CRISPR)
KN517714 1 Kit

Tmem129 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details