PF-4/CXCL4, Mouse
Platelet factor 4 (PF4) is released during platelet aggregation and neutralizes the anticoagulant effect of heparin with a higher binding affinity than chondroitin 4-sulfate chains. In addition to its anticoagulant effects, PF4 induces neutrophil and monocyte chemotaxis, thereby promoting immune responses. PF-4/CXCL4 Protein, Mouse is the recombinant mouse-derived Platelet factor 4 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
PF-4/CXCL4 Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/platelet-factor-4-protein-mouse.html
Purity
97.00
Smiles
VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES
Molecular Formula
56744 (Gene_ID) Q9Z126 (V30-S105) (Accession)
Molecular Weight
Approximately 8.2-12 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Anti-Bovine Serum Albumin/BSA Antibody (12D6), HRP
Anti-Bovine Serum Albumin/BSA Antibody (12D6), HRP
Anti-Bovine Serum Albumin/BSA Antibody (12D6), HRP
AP4M1, ID (AP4M1, MUARP2, AP-4 complex subunit mu-1, AP-4 adapter complex mu subunit, Adapter-related protein complex 4 mu-1 subunit, Mu subunit of AP-4, Mu-adaptin-related protein 2, Mu4-adaptin) (FITC)
AP4M1, ID (AP4M1, MUARP2, AP-4 complex subunit mu-1, AP-4 adapter complex mu subunit, Adapter-related protein complex 4 mu-1 subunit, Mu subunit of AP-4, Mu-adaptin-related protein 2, Mu4-adaptin) (FITC)
