PF-4/CXCL4, Mouse
Platelet factor 4 (PF4) is released during platelet aggregation and neutralizes the anticoagulant effect of heparin with a higher binding affinity than chondroitin 4-sulfate chains. In addition to its anticoagulant effects, PF4 induces neutrophil and monocyte chemotaxis, thereby promoting immune responses. PF-4/CXCL4 Protein, Mouse is the recombinant mouse-derived Platelet factor 4 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
PF-4/CXCL4 Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/platelet-factor-4-protein-mouse.html
Purity
97.00
Smiles
VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES
Molecular Formula
56744 (Gene_ID) Q9Z126 (V30-S105) (Accession)
Molecular Weight
Approximately 8.2-12 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
SHPRH (SNF2 Histone-linker PHD RING-finger Helicase, Ubquitin Ligase, E3 Ubiquitin-Protein Ligase, SNF2 Histone Linker PHD RING Helicase) (MaxLight 650)
Lentiviral mouse Gabra2 shRNA (UAS) - Lentiviral mouse Gabra2 shRNA (UAS, RFP) (100)