Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PF-4/CXCL4, Mouse

Platelet factor 4 (PF4) is released during platelet aggregation and neutralizes the anticoagulant effect of heparin with a higher binding affinity than chondroitin 4-sulfate chains. In addition to its anticoagulant effects, PF4 induces neutrophil and monocyte chemotaxis, thereby promoting immune responses. PF-4/CXCL4 Protein, Mouse is the recombinant mouse-derived Platelet factor 4 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

PF-4/CXCL4 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/platelet-factor-4-protein-mouse.html

Purity

97.00

Smiles

VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES

Molecular Formula

56744 (Gene_ID) Q9Z126 (V30-S105) (Accession)

Molecular Weight

Approximately 8.2-12 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXL22 293 Cell Lysate
403324 0.1 mg

FBXL22 293 Cell Lysate

Sign In for Pricing
View Details
MTNR1A Peptide
46-987P 0.1 mg

MTNR1A Peptide

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Growth Associated Protein 43 (GAP43)
MBS2053937-01 0.1 mL

FITC-Linked Polyclonal Antibody to Growth Associated Protein 43 (GAP43)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Growth Associated Protein 43 (GAP43)
MBS2053937-02 0.2 mL

FITC-Linked Polyclonal Antibody to Growth Associated Protein 43 (GAP43)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Growth Associated Protein 43 (GAP43)
MBS2053937-03 0.5 mL

FITC-Linked Polyclonal Antibody to Growth Associated Protein 43 (GAP43)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Growth Associated Protein 43 (GAP43)
MBS2053937-04 1 mL

FITC-Linked Polyclonal Antibody to Growth Associated Protein 43 (GAP43)

Sign In for Pricing
View Details