Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Human (HEK293, hFc)

IL-13 Protein, Human (HEK293, Fc) is a cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. IL-13 Protein, Human (HEK293, Fc) is a recombinant human interleukin-13 (rhIL-13) expressed in HEK 293 cells with the Fc tag.

Product Specifications

Product Name Alternative

IL-13 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-human-hek293-hfc.html

Purity

95.0

Smiles

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Molecular Formula

3596 (Gene_ID) AAK53823.1 (G21-N132) (Accession)

Molecular Weight

Approximately 39-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Cannon-Carlson S, et al. Expression, purification, and characterization of recombinant human interleukin-13 from NS-O cells. Protein Expr Purif. 1998 Mar;12 (2) :239-48.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal RSAD1 Antibody
NBP1-83771-25ul 25 µL

Rabbit Polyclonal RSAD1 Antibody

Sign In for Pricing
View Details
Human CXCR6 shRNA Plasmid
abx957270-01 150 µg

Human CXCR6 shRNA Plasmid

Sign In for Pricing
View Details
Human CXCR6 shRNA Plasmid
abx957270-02 300 µg

Human CXCR6 shRNA Plasmid

Sign In for Pricing
View Details
MAPK6 Recombinant Protein (Rat)
RP210821 100 µg

MAPK6 Recombinant Protein (Rat)

Sign In for Pricing
View Details
MARK1 Rabbit pAb (APR28222N)
APR28222N-01 50 µL

MARK1 Rabbit pAb (APR28222N)

Sign In for Pricing
View Details
MARK1 Rabbit pAb (APR28222N)
APR28222N-02 100 µL

MARK1 Rabbit pAb (APR28222N)

Sign In for Pricing
View Details