Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Human (HEK293, hFc)

IL-13 Protein, Human (HEK293, Fc) is a cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. IL-13 Protein, Human (HEK293, Fc) is a recombinant human interleukin-13 (rhIL-13) expressed in HEK 293 cells with the Fc tag.

Product Specifications

Product Name Alternative

IL-13 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-human-hek293-hfc.html

Purity

95.0

Smiles

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Molecular Formula

3596 (Gene_ID) AAK53823.1 (G21-N132) (Accession)

Molecular Weight

Approximately 39-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Cannon-Carlson S, et al. Expression, purification, and characterization of recombinant human interleukin-13 from NS-O cells. Protein Expr Purif. 1998 Mar;12 (2) :239-48.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GALNT12 (NM_024642) Human Over-expression Lysate
LS079695-20ug 20 µg

GALNT12 (NM_024642) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit Anti-Human RBM12B pAb
PA6865-01 50 μL

Rabbit Anti-Human RBM12B pAb

Sign In for Pricing
View Details
Rabbit Anti-Human RBM12B pAb
PA6865-02 100 μL

Rabbit Anti-Human RBM12B pAb

Sign In for Pricing
View Details
Mouse Mthfd2 ELISA Kit
EF014308 96 Tests

Mouse Mthfd2 ELISA Kit

Sign In for Pricing
View Details
Recombinant Clostridium Thermocellum hemC Protein (aa 1-292)
VAng-Lsx01961-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Thermocellum hemC Protein (aa 1-292)

Sign In for Pricing
View Details
Narf (NM_026272) Mouse Untagged Clone
MC201272 10 µg

Narf (NM_026272) Mouse Untagged Clone

Sign In for Pricing
View Details