Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Human (HEK293, hFc)

IL-13 Protein, Human (HEK293, Fc) is a cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. IL-13 Protein, Human (HEK293, Fc) is a recombinant human interleukin-13 (rhIL-13) expressed in HEK 293 cells with the Fc tag.

Product Specifications

Product Name Alternative

IL-13 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-human-hek293-hfc.html

Purity

95.0

Smiles

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Molecular Formula

3596 (Gene_ID) AAK53823.1 (G21-N132) (Accession)

Molecular Weight

Approximately 39-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Cannon-Carlson S, et al. Expression, purification, and characterization of recombinant human interleukin-13 from NS-O cells. Protein Expr Purif. 1998 Mar;12 (2) :239-48.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Natranaerobius thermophilus Ribosome maturation factor RimM (rimM)
MBS1138334-01 0.02 mg (E-Coli)

Recombinant Natranaerobius thermophilus Ribosome maturation factor RimM (rimM)

Sign In for Pricing
View Details
Recombinant Natranaerobius thermophilus Ribosome maturation factor RimM (rimM)
MBS1138334-02 0.1 mg (E-Coli)

Recombinant Natranaerobius thermophilus Ribosome maturation factor RimM (rimM)

Sign In for Pricing
View Details
Recombinant Natranaerobius thermophilus Ribosome maturation factor RimM (rimM)
MBS1138334-03 0.02 mg (Yeast)

Recombinant Natranaerobius thermophilus Ribosome maturation factor RimM (rimM)

Sign In for Pricing
View Details
Recombinant Natranaerobius thermophilus Ribosome maturation factor RimM (rimM)
MBS1138334-04 0.1 mg (Yeast)

Recombinant Natranaerobius thermophilus Ribosome maturation factor RimM (rimM)

Sign In for Pricing
View Details
Recombinant Natranaerobius thermophilus Ribosome maturation factor RimM (rimM)
MBS1138334-05 0.02 mg (Baculovirus)

Recombinant Natranaerobius thermophilus Ribosome maturation factor RimM (rimM)

Sign In for Pricing
View Details
Recombinant Natranaerobius thermophilus Ribosome maturation factor RimM (rimM)
MBS1138334-06 0.02 mg (Mammalian-Cell)

Recombinant Natranaerobius thermophilus Ribosome maturation factor RimM (rimM)

Sign In for Pricing
View Details