Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Human (HEK293, hFc)

IL-13 Protein, Human (HEK293, Fc) is a cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. IL-13 Protein, Human (HEK293, Fc) is a recombinant human interleukin-13 (rhIL-13) expressed in HEK 293 cells with the Fc tag.

Product Specifications

Product Name Alternative

IL-13 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-human-hek293-hfc.html

Purity

95.0

Smiles

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Molecular Formula

3596 (Gene_ID) AAK53823.1 (G21-N132) (Accession)

Molecular Weight

Approximately 39-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Cannon-Carlson S, et al. Expression, purification, and characterization of recombinant human interleukin-13 from NS-O cells. Protein Expr Purif. 1998 Mar;12 (2) :239-48.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Prolactin R Antibody (B6.2) [Alexa Fluor 488]
NBP2-34554AF488 0.1 mL

Mouse Monoclonal Prolactin R Antibody (B6.2) [Alexa Fluor 488]

Sign In for Pricing
View Details
SEMA7A siRNA Oligos set (Human)
43361171 3x 5 nmol

SEMA7A siRNA Oligos set (Human)

Sign In for Pricing
View Details
Spink10 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
45327124 3x 1.0µg DNA

Spink10 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Recombinant Human INCENP Protein
E30P399 20 µg

Recombinant Human INCENP Protein

Sign In for Pricing
View Details
CHRNB1 Rabbit pAb (APR25702N)
APR25702N-01 50 µL

CHRNB1 Rabbit pAb (APR25702N)

Sign In for Pricing
View Details
CHRNB1 Rabbit pAb (APR25702N)
APR25702N-02 100 µL

CHRNB1 Rabbit pAb (APR25702N)

Sign In for Pricing
View Details