Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Human (HEK293, hFc)

IL-13 Protein, Human (HEK293, Fc) is a cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. IL-13 Protein, Human (HEK293, Fc) is a recombinant human interleukin-13 (rhIL-13) expressed in HEK 293 cells with the Fc tag.

Product Specifications

Product Name Alternative

IL-13 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-human-hek293-hfc.html

Purity

95.0

Smiles

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Molecular Formula

3596 (Gene_ID) AAK53823.1 (G21-N132) (Accession)

Molecular Weight

Approximately 39-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Cannon-Carlson S, et al. Expression, purification, and characterization of recombinant human interleukin-13 from NS-O cells. Protein Expr Purif. 1998 Mar;12 (2) :239-48.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-HER2 (Y1112) Rabbit Polyclonal Antibody
E28PB4497 100 µL

Phospho-HER2 (Y1112) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bmf sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7341407 1.0 µg DNA

Bmf sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
BSPH1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0197908 1.0 µg DNA

BSPH1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
VSIG8 Protein Vector (Human) (pPM-C-HA)
PV059723 500 ng

VSIG8 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Tbx3 Rabbit mAb
E60M3401 100 µL

Tbx3 Rabbit mAb

Sign In for Pricing
View Details
HNRNPF (Heterogeneous nuclear ribonucleoprotein F) BioAssayTM ELISA Kit (Human) discontinued
356316-01 48 Tests

HNRNPF (Heterogeneous nuclear ribonucleoprotein F) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details