Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Human (HEK293, hFc)

IL-13 Protein, Human (HEK293, Fc) is a cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. IL-13 Protein, Human (HEK293, Fc) is a recombinant human interleukin-13 (rhIL-13) expressed in HEK 293 cells with the Fc tag.

Product Specifications

Product Name Alternative

IL-13 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-human-hek293-hfc.html

Purity

95.0

Smiles

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Molecular Formula

3596 (Gene_ID) AAK53823.1 (G21-N132) (Accession)

Molecular Weight

Approximately 39-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Cannon-Carlson S, et al. Expression, purification, and characterization of recombinant human interleukin-13 from NS-O cells. Protein Expr Purif. 1998 Mar;12 (2) :239-48.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBRG4 (Transforming Growth Factor beta Regulator 4, CPR2, Cell Cycle Progression Restoration Protein 2, FASTKD4, KIAA0948) (MaxLight 550)
MBS6440022-01 0.1 mL

TBRG4 (Transforming Growth Factor beta Regulator 4, CPR2, Cell Cycle Progression Restoration Protein 2, FASTKD4, KIAA0948) (MaxLight 550)

Sign In for Pricing
View Details
TBRG4 (Transforming Growth Factor beta Regulator 4, CPR2, Cell Cycle Progression Restoration Protein 2, FASTKD4, KIAA0948) (MaxLight 550)
MBS6440022-02 5x 0.1 mL

TBRG4 (Transforming Growth Factor beta Regulator 4, CPR2, Cell Cycle Progression Restoration Protein 2, FASTKD4, KIAA0948) (MaxLight 550)

Sign In for Pricing
View Details
Mouse Cux1 (NM_001291240) AAV Particle
MR231092A1V 250 µL

Mouse Cux1 (NM_001291240) AAV Particle

Sign In for Pricing
View Details
Cow Interleukin 34 (IL34) ELISA Kit
abx519116 96 Tests

Cow Interleukin 34 (IL34) ELISA Kit

Sign In for Pricing
View Details
Cytomegalovirus (CMV-pp28)
470595 100 µg

Cytomegalovirus (CMV-pp28)

Sign In for Pricing
View Details
Soyabean Casein Digest Medium w/ 0.5% So
LQ194XC-10X90ML 1 unit

Soyabean Casein Digest Medium w/ 0.5% So

Sign In for Pricing
View Details