Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Human (HEK293, hFc)

IL-13 Protein, Human (HEK293, Fc) is a cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. IL-13 Protein, Human (HEK293, Fc) is a recombinant human interleukin-13 (rhIL-13) expressed in HEK 293 cells with the Fc tag.

Product Specifications

Product Name Alternative

IL-13 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-human-hek293-hfc.html

Purity

95.0

Smiles

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Molecular Formula

3596 (Gene_ID) AAK53823.1 (G21-N132) (Accession)

Molecular Weight

Approximately 39-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Cannon-Carlson S, et al. Expression, purification, and characterization of recombinant human interleukin-13 from NS-O cells. Protein Expr Purif. 1998 Mar;12 (2) :239-48.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCMV-Igk-PDE4D-Myc-6×His-Zeo Plasmid
PVT49425 2 µg

pCMV-Igk-PDE4D-Myc-6×His-Zeo Plasmid

Sign In for Pricing
View Details
Lentiviral mouse Ankrd55 shRNA (UAS) - Lentiviral mouse Ankrd55 shRNA (UAS) plasmid
GTR15305386 1 Vial

Lentiviral mouse Ankrd55 shRNA (UAS) - Lentiviral mouse Ankrd55 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Slco6d1 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6330802 1.0 µg DNA

Slco6d1 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Tnnc1 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6758202 1.0 µg DNA

Tnnc1 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Mouse Growth differentiation factor 8 (GDF8; MSTN) ELISA Kit
YP-W28355-01 48 Tests

Mouse Growth differentiation factor 8 (GDF8; MSTN) ELISA Kit

Sign In for Pricing
View Details
Mouse Growth differentiation factor 8 (GDF8; MSTN) ELISA Kit
YP-W28355-02 96 Tests

Mouse Growth differentiation factor 8 (GDF8; MSTN) ELISA Kit

Sign In for Pricing
View Details