Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Human (HEK293, hFc)

IL-13 Protein, Human (HEK293, Fc) is a cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. IL-13 Protein, Human (HEK293, Fc) is a recombinant human interleukin-13 (rhIL-13) expressed in HEK 293 cells with the Fc tag.

Product Specifications

Product Name Alternative

IL-13 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-human-hek293-hfc.html

Purity

95.0

Smiles

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Molecular Formula

3596 (Gene_ID) AAK53823.1 (G21-N132) (Accession)

Molecular Weight

Approximately 39-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Cannon-Carlson S, et al. Expression, purification, and characterization of recombinant human interleukin-13 from NS-O cells. Protein Expr Purif. 1998 Mar;12 (2) :239-48.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCC8  polyclonal antibody
BS79088 50ul

ABCC8 polyclonal antibody

Sign In for Pricing
View Details
Glutamic Acid Decarboxylase (GAD) (MaxLight 490)
G7116-05-ML490 100 µL

Glutamic Acid Decarboxylase (GAD) (MaxLight 490)

Sign In for Pricing
View Details
Human CBFB knockout cell line
ABC-KH2409 1 Vial

Human CBFB knockout cell line

Sign In for Pricing
View Details
Recombinant Anti-SERCA2 Rabbit mAb
CMA5583-01 30 µL

Recombinant Anti-SERCA2 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-SERCA2 Rabbit mAb
CMA5583-02 50 μL

Recombinant Anti-SERCA2 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-SERCA2 Rabbit mAb
CMA5583-03 100 µL

Recombinant Anti-SERCA2 Rabbit mAb

Sign In for Pricing
View Details