Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Human (HEK293, hFc)

IL-13 Protein, Human (HEK293, Fc) is a cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. IL-13 Protein, Human (HEK293, Fc) is a recombinant human interleukin-13 (rhIL-13) expressed in HEK 293 cells with the Fc tag.

Product Specifications

Product Name Alternative

IL-13 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-human-hek293-hfc.html

Purity

95.0

Smiles

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Molecular Formula

3596 (Gene_ID) AAK53823.1 (G21-N132) (Accession)

Molecular Weight

Approximately 39-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Cannon-Carlson S, et al. Expression, purification, and characterization of recombinant human interleukin-13 from NS-O cells. Protein Expr Purif. 1998 Mar;12 (2) :239-48.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TM4SF1 (Beth Israel Patent TM4SF1) discontinued
048609 100 µg

TM4SF1 (Beth Israel Patent TM4SF1) discontinued

Sign In for Pricing
View Details
GHDC (NM_001142622) Human Tagged ORF Clone
RC226590 10 µg

GHDC (NM_001142622) Human Tagged ORF Clone

Sign In for Pricing
View Details
MGC3207 (Translation Initiation Factor EIF-2B Subunit Alpha/Beta/Delta-Like Protein) (MaxLight 550)
MBS6212523-01 0.1 mL

MGC3207 (Translation Initiation Factor EIF-2B Subunit Alpha/Beta/Delta-Like Protein) (MaxLight 550)

Sign In for Pricing
View Details
MGC3207 (Translation Initiation Factor EIF-2B Subunit Alpha/Beta/Delta-Like Protein) (MaxLight 550)
MBS6212523-02 5x 0.1 mL

MGC3207 (Translation Initiation Factor EIF-2B Subunit Alpha/Beta/Delta-Like Protein) (MaxLight 550)

Sign In for Pricing
View Details
Rabbit Polyclonal NHE1/SLC9A1 Antibody
NBP2-38683-25ul 25 µL

Rabbit Polyclonal NHE1/SLC9A1 Antibody

Sign In for Pricing
View Details
Isoprenaline (Isoproterenol) HCl
C08676-01 50 mg

Isoprenaline (Isoproterenol) HCl

Sign In for Pricing
View Details