Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Human (HEK293, hFc)

IL-13 Protein, Human (HEK293, Fc) is a cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. IL-13 Protein, Human (HEK293, Fc) is a recombinant human interleukin-13 (rhIL-13) expressed in HEK 293 cells with the Fc tag.

Product Specifications

Product Name Alternative

IL-13 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-human-hek293-hfc.html

Purity

95.0

Smiles

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Molecular Formula

3596 (Gene_ID) AAK53823.1 (G21-N132) (Accession)

Molecular Weight

Approximately 39-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Cannon-Carlson S, et al. Expression, purification, and characterization of recombinant human interleukin-13 from NS-O cells. Protein Expr Purif. 1998 Mar;12 (2) :239-48.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hdac9 ORF Vector (Mouse) (pORF)
ORF047051 1.0 µg DNA

Hdac9 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
MRP2 polyclonal antibody
BS5801 50ul

MRP2 polyclonal antibody

Sign In for Pricing
View Details
Trim27 Mouse shRNA Lentiviral Particle (Locus ID 19720)
TL501893V 500 µL Each

Trim27 Mouse shRNA Lentiviral Particle (Locus ID 19720)

Sign In for Pricing
View Details
EPHA5 (EPH Receptor A5, CEK7, EHK1, HEK7, TYRO4, Eph Homology Kinase-1, Ephrin Receptor EphA5, Ephrin Type-A Receptor 5, Receptor Protein-Tyrosine Kinase HEK7, Tyrosine-Protein Kinase Receptor EHK-1) (MaxLight 550)
207593-ML550 100 µL

EPHA5 (EPH Receptor A5, CEK7, EHK1, HEK7, TYRO4, Eph Homology Kinase-1, Ephrin Receptor EphA5, Ephrin Type-A Receptor 5, Receptor Protein-Tyrosine Kinase HEK7, Tyrosine-Protein Kinase Receptor EHK-1) (MaxLight 550)

Sign In for Pricing
View Details
Frozen Tissue Sections, Metastasis, unknown source
CS600781 5x 5 µm

Frozen Tissue Sections, Metastasis, unknown source

Sign In for Pricing
View Details
Olfr934 (NM_146442) Mouse Tagged Lenti ORF Clone
MR212770L4 10 µg

Olfr934 (NM_146442) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details