Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Human (HEK293, hFc)

IL-13 Protein, Human (HEK293, Fc) is a cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. IL-13 Protein, Human (HEK293, Fc) is a recombinant human interleukin-13 (rhIL-13) expressed in HEK 293 cells with the Fc tag.

Product Specifications

Product Name Alternative

IL-13 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-human-hek293-hfc.html

Purity

95.0

Smiles

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Molecular Formula

3596 (Gene_ID) AAK53823.1 (G21-N132) (Accession)

Molecular Weight

Approximately 39-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Cannon-Carlson S, et al. Expression, purification, and characterization of recombinant human interleukin-13 from NS-O cells. Protein Expr Purif. 1998 Mar;12 (2) :239-48.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Silyamandin
MF-0044402 5 mg

Silyamandin

Sign In for Pricing
View Details
B4galt6 antibody - C-terminal region
MBS3208236-01 0.1 mL

B4galt6 antibody - C-terminal region

Sign In for Pricing
View Details
B4galt6 antibody - C-terminal region
MBS3208236-02 5x 0.1 mL

B4galt6 antibody - C-terminal region

Sign In for Pricing
View Details
Scn3b sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3884106 1.0 µg DNA

Scn3b sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
CBX4 Recombinant Rabbit mAb
E43S46044 100 µL

CBX4 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Rabbit Polyclonal PCYOX1L Antibody [mFluor Violet 610 SE]
NBP2-97684MFV610 0.1 mL

Rabbit Polyclonal PCYOX1L Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details