Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Human (HEK293, hFc)

IL-13 Protein, Human (HEK293, Fc) is a cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. IL-13 Protein, Human (HEK293, Fc) is a recombinant human interleukin-13 (rhIL-13) expressed in HEK 293 cells with the Fc tag.

Product Specifications

Product Name Alternative

IL-13 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-human-hek293-hfc.html

Purity

95.0

Smiles

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Molecular Formula

3596 (Gene_ID) AAK53823.1 (G21-N132) (Accession)

Molecular Weight

Approximately 39-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Cannon-Carlson S, et al. Expression, purification, and characterization of recombinant human interleukin-13 from NS-O cells. Protein Expr Purif. 1998 Mar;12 (2) :239-48.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNX27 Protein Lysate (Mouse) with C-HA Tag
45069034 100 µg

SNX27 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Trim33 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4354603 1.0 µg DNA

Trim33 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Connective Tissue Growth Factor (CTGF) DIY ELISA Kit
MBS2162904-01 5x 96 Tests

Connective Tissue Growth Factor (CTGF) DIY ELISA Kit

Sign In for Pricing
View Details
Connective Tissue Growth Factor (CTGF) DIY ELISA Kit
MBS2162904-02 5x 96 Tests + MBS2089471 (Support Pack 1,5x 96 Tests)

Connective Tissue Growth Factor (CTGF) DIY ELISA Kit

Sign In for Pricing
View Details
Connective Tissue Growth Factor (CTGF) DIY ELISA Kit
MBS2162904-03 10x 96 Tests

Connective Tissue Growth Factor (CTGF) DIY ELISA Kit

Sign In for Pricing
View Details
Connective Tissue Growth Factor (CTGF) DIY ELISA Kit
MBS2162904-04 10x 96 Tests + MBS2089471 (Support Pack 1, 10x 96 Tests)

Connective Tissue Growth Factor (CTGF) DIY ELISA Kit

Sign In for Pricing
View Details