Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Human (HEK293, hFc)

IL-13 Protein, Human (HEK293, Fc) is a cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. IL-13 Protein, Human (HEK293, Fc) is a recombinant human interleukin-13 (rhIL-13) expressed in HEK 293 cells with the Fc tag.

Product Specifications

Product Name Alternative

IL-13 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-human-hek293-hfc.html

Purity

95.0

Smiles

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Molecular Formula

3596 (Gene_ID) AAK53823.1 (G21-N132) (Accession)

Molecular Weight

Approximately 39-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Cannon-Carlson S, et al. Expression, purification, and characterization of recombinant human interleukin-13 from NS-O cells. Protein Expr Purif. 1998 Mar;12 (2) :239-48.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monofunctional C1-Tetrahydrofolate Synthase, Mitochondrial (MTHFD1L) Peptide
abx616581 100 µg

Monofunctional C1-Tetrahydrofolate Synthase, Mitochondrial (MTHFD1L) Peptide

Sign In for Pricing
View Details
Wnt5a Mouse Gene Knockout Kit (CRISPR)
KN319455RB 1 Kit

Wnt5a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BC117090 sgRNA CRISPR Lentivector set (Mouse)
K4323601 3x 1.0 µg

BC117090 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Recombinant Chlamydia muridarum Phosphatidate cytidylyltransferase (cdsA), partial
MBS7099955 Inquire

Recombinant Chlamydia muridarum Phosphatidate cytidylyltransferase (cdsA), partial

Sign In for Pricing
View Details
CD48 Antibody
DF8214-01 100 µL

CD48 Antibody

Sign In for Pricing
View Details
CD48 Antibody
DF8214-02 200 µL

CD48 Antibody

Sign In for Pricing
View Details