Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Human (HEK293, hFc)

IL-13 Protein, Human (HEK293, Fc) is a cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. IL-13 Protein, Human (HEK293, Fc) is a recombinant human interleukin-13 (rhIL-13) expressed in HEK 293 cells with the Fc tag.

Product Specifications

Product Name Alternative

IL-13 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-human-hek293-hfc.html

Purity

95.0

Smiles

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Molecular Formula

3596 (Gene_ID) AAK53823.1 (G21-N132) (Accession)

Molecular Weight

Approximately 39-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Cannon-Carlson S, et al. Expression, purification, and characterization of recombinant human interleukin-13 from NS-O cells. Protein Expr Purif. 1998 Mar;12 (2) :239-48.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-CD43 Antibody, Affinity Purified
A304-393A 100 µg

Rabbit anti-CD43 Antibody, Affinity Purified

Sign In for Pricing
View Details
POLR3C Protein Vector (Rat) (pPB-C-His)
PV295174 500 ng

POLR3C Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
AdmiRa-Off-hsa-miR-8089 Virus
mh7573 1.0 mL

AdmiRa-Off-hsa-miR-8089 Virus

Sign In for Pricing
View Details
RRM2P2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV747568 1.0 µg DNA

RRM2P2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
NMNAT1 (Nicotinamide Mononucleotide Adenylyltransferase 1, LCA9, NMNAT, PNAT1) (MaxLight 490)
MBS6429263-01 0.1 mL

NMNAT1 (Nicotinamide Mononucleotide Adenylyltransferase 1, LCA9, NMNAT, PNAT1) (MaxLight 490)

Sign In for Pricing
View Details
NMNAT1 (Nicotinamide Mononucleotide Adenylyltransferase 1, LCA9, NMNAT, PNAT1) (MaxLight 490)
MBS6429263-02 5x 0.1 mL

NMNAT1 (Nicotinamide Mononucleotide Adenylyltransferase 1, LCA9, NMNAT, PNAT1) (MaxLight 490)

Sign In for Pricing
View Details