Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Human (HEK293, hFc)

IL-13 Protein, Human (HEK293, Fc) is a cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. IL-13 Protein, Human (HEK293, Fc) is a recombinant human interleukin-13 (rhIL-13) expressed in HEK 293 cells with the Fc tag.

Product Specifications

Product Name Alternative

IL-13 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-human-hek293-hfc.html

Purity

95.0

Smiles

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Molecular Formula

3596 (Gene_ID) AAK53823.1 (G21-N132) (Accession)

Molecular Weight

Approximately 39-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Cannon-Carlson S, et al. Expression, purification, and characterization of recombinant human interleukin-13 from NS-O cells. Protein Expr Purif. 1998 Mar;12 (2) :239-48.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP14 siRNA (Mouse)
CRM2558-01 15 nmol

MMP14 siRNA (Mouse)

Sign In for Pricing
View Details
MMP14 siRNA (Mouse)
CRM2558-02 30 nmol

MMP14 siRNA (Mouse)

Sign In for Pricing
View Details
STAT4 Mouse Monoclonal Antibody [Clone ID: OTI3B6]
TA503024S 30 µL

STAT4 Mouse Monoclonal Antibody [Clone ID: OTI3B6]

Sign In for Pricing
View Details
Gbe1 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6723104 1.0 µg DNA

Gbe1 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Rabbit Anti-Rat Complement Component 3a (C3a) Polyclonal Antibody
VD3N389 1 Each

Rabbit Anti-Rat Complement Component 3a (C3a) Polyclonal Antibody

Sign In for Pricing
View Details
CCT6B sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0397405 3x 1.0 µg

CCT6B sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details