IL-13, Human (HEK293, hFc)
IL-13 Protein, Human (HEK293, Fc) is a cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. IL-13 Protein, Human (HEK293, Fc) is a recombinant human interleukin-13 (rhIL-13) expressed in HEK 293 cells with the Fc tag.
Product Specifications
Product Name Alternative
IL-13 Protein, Human (HEK293, hFc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-13-protein-human-hek293-hfc.html
Purity
95.0
Smiles
GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN
Molecular Formula
3596 (Gene_ID) AAK53823.1 (G21-N132) (Accession)
Molecular Weight
Approximately 39-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Gm4179 sgRNA CRISPR Lentivector (Mouse) (Target 2)
Mouse Tumor Necrosis Factor Alpha (TNFa), Active Protein
Mouse Tumor Necrosis Factor Alpha (TNFa), Active Protein
Mouse Tumor Necrosis Factor Alpha (TNFa), Active Protein
ZDHHC8, CT (ZDHHC8, KIAA1292, ZDHHCL1, ZNF378, Probable palmitoyltransferase ZDHHC8, Zinc finger DHHC domain-containing protein 8, Zinc finger protein 378) (PE)