Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Human (HEK293, hFc)

IL-13 Protein, Human (HEK293, Fc) is a cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. IL-13 Protein, Human (HEK293, Fc) is a recombinant human interleukin-13 (rhIL-13) expressed in HEK 293 cells with the Fc tag.

Product Specifications

Product Name Alternative

IL-13 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-human-hek293-hfc.html

Purity

95.0

Smiles

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Molecular Formula

3596 (Gene_ID) AAK53823.1 (G21-N132) (Accession)

Molecular Weight

Approximately 39-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Cannon-Carlson S, et al. Expression, purification, and characterization of recombinant human interleukin-13 from NS-O cells. Protein Expr Purif. 1998 Mar;12 (2) :239-48.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Mreg shRNA (UAS) - Lentiviral mouse Mreg shRNA (UAS, RFP) (100)
GTR15112836 1 Vial

Lentiviral mouse Mreg shRNA (UAS) - Lentiviral mouse Mreg shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Recombinant Mouse Wnt-3a CF
1324-WN-002/CF 2 µg

Recombinant Mouse Wnt-3a CF

Sign In for Pricing
View Details
SUGT1P1 Human shRNA Lentiviral Particle (Locus ID 441394)
TL318646V 500 µL Each

SUGT1P1 Human shRNA Lentiviral Particle (Locus ID 441394)

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis Fumarate reductase iron-sulfur subunit (frdB)
MBS1426504-01 0.02 mg (E-Coli)

Recombinant Mycobacterium tuberculosis Fumarate reductase iron-sulfur subunit (frdB)

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis Fumarate reductase iron-sulfur subunit (frdB)
MBS1426504-02 0.1 mg (E-Coli)

Recombinant Mycobacterium tuberculosis Fumarate reductase iron-sulfur subunit (frdB)

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis Fumarate reductase iron-sulfur subunit (frdB)
MBS1426504-03 0.02 mg (Yeast)

Recombinant Mycobacterium tuberculosis Fumarate reductase iron-sulfur subunit (frdB)

Sign In for Pricing
View Details