Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Human (HEK293, hFc)

IL-13 Protein, Human (HEK293, Fc) is a cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. IL-13 Protein, Human (HEK293, Fc) is a recombinant human interleukin-13 (rhIL-13) expressed in HEK 293 cells with the Fc tag.

Product Specifications

Product Name Alternative

IL-13 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-human-hek293-hfc.html

Purity

95.0

Smiles

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Molecular Formula

3596 (Gene_ID) AAK53823.1 (G21-N132) (Accession)

Molecular Weight

Approximately 39-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Cannon-Carlson S, et al. Expression, purification, and characterization of recombinant human interleukin-13 from NS-O cells. Protein Expr Purif. 1998 Mar;12 (2) :239-48.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RN5S193 Protein Vector (Human) (pPM-C-His)
PV116329 500 ng

RN5S193 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
CD3EAP, NT (DNA-directed RNA polymerase I subunit RPA34, RNA polymerase I-associated factor PAF49, Anti-sense to ERCC-1 protein, ASE-1, CD3-epsilon-associated protein, CD3E-associated protein, CAST, A34.5, PAF49, CAST, ASE1, CD3EAP) (Azide free) (HRP) discontinued
033504-HRP 200 µL

CD3EAP, NT (DNA-directed RNA polymerase I subunit RPA34, RNA polymerase I-associated factor PAF49, Anti-sense to ERCC-1 protein, ASE-1, CD3-epsilon-associated protein, CD3E-associated protein, CAST, A34.5, PAF49, CAST, ASE1, CD3EAP) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Hoxa11 Mouse shRNA Lentiviral Particle (Locus ID 15396)
TL512291V 500 µL Each

Hoxa11 Mouse shRNA Lentiviral Particle (Locus ID 15396)

Sign In for Pricing
View Details
Polyclonal Spondin 2 / Mindin Antibody (internal region)
APR13519G 0.1 mg

Polyclonal Spondin 2 / Mindin Antibody (internal region)

Sign In for Pricing
View Details
Chebulinic acid 10mM * 1mL in DMSO
A16208-10mM-D 10 mM x 1mL in DMSO

Chebulinic acid 10mM * 1mL in DMSO

Sign In for Pricing
View Details
HOXB2, CT
501816 200 µL

HOXB2, CT

Sign In for Pricing
View Details