Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Human (HEK293, hFc)

IL-13 Protein, Human (HEK293, Fc) is a cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. IL-13 Protein, Human (HEK293, Fc) is a recombinant human interleukin-13 (rhIL-13) expressed in HEK 293 cells with the Fc tag.

Product Specifications

Product Name Alternative

IL-13 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-human-hek293-hfc.html

Purity

95.0

Smiles

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Molecular Formula

3596 (Gene_ID) AAK53823.1 (G21-N132) (Accession)

Molecular Weight

Approximately 39-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Cannon-Carlson S, et al. Expression, purification, and characterization of recombinant human interleukin-13 from NS-O cells. Protein Expr Purif. 1998 Mar;12 (2) :239-48.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACCSL Protein Vector (Human) (pPB-N-His)
PV060866 500 ng

ACCSL Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
PRAMEF16 (NM_001045480) Human Tagged ORF Clone
RG224687 10 µg

PRAMEF16 (NM_001045480) Human Tagged ORF Clone

Sign In for Pricing
View Details
SNORD113-2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2237408 1.0 µg DNA

SNORD113-2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Glutathione S-Transferase (GST) (HRP) discontinued
G8135-08-HRP 100 µL

Glutathione S-Transferase (GST) (HRP) discontinued

Sign In for Pricing
View Details
Rat calmodulin (CaM) ELISA Kit
YP-W35057-01 48 Tests

Rat calmodulin (CaM) ELISA Kit

Sign In for Pricing
View Details
Rat calmodulin (CaM) ELISA Kit
YP-W35057-02 96 Tests

Rat calmodulin (CaM) ELISA Kit

Sign In for Pricing
View Details