Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR4A2, Human (P.pastoris, His)

NR4A2, a crucial transcriptional regulator, is vital for the differentiation and maintenance of meso-diencephalic dopaminergic (mdDA) neurons. It plays a pivotal role in the expression of key genes (SLC6A3, SLC18A2, TH, DRD2) essential for mdDA neuron development. Interactions with SFPQ, NCOR2, SIN3A, HADC1, and PER2 contribute to its regulatory functions in mdDA neuron development, with the NCOR2 interaction influenced by the absence of PITX3. NR4A2 Protein, Human (P.pastoris, His) is the recombinant human-derived NR4A2 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

NR4A2 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nr4a2-protein-human-p-pastoris-his.html

Smiles

MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKPSSPPTPTTPGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF

Molecular Formula

4929 (Gene_ID) P43354 (M1-F598) (Accession)

Molecular Weight

Approximately 68.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Signal-regulatory protein delta, SIRPD ELISA Kit
MBS9325993-01 48 Well

Human Signal-regulatory protein delta, SIRPD ELISA Kit

Ask
View Details
Human Signal-regulatory protein delta, SIRPD ELISA Kit
MBS9325993-02 96 Well

Human Signal-regulatory protein delta, SIRPD ELISA Kit

Ask
View Details
Human Signal-regulatory protein delta, SIRPD ELISA Kit
MBS9325993-03 5x 96 Well

Human Signal-regulatory protein delta, SIRPD ELISA Kit

Ask
View Details
Human Signal-regulatory protein delta, SIRPD ELISA Kit
MBS9325993-04 10x 96 Well

Human Signal-regulatory protein delta, SIRPD ELISA Kit

Ask
View Details
Recombinant Human PSMC3IP
MBS7614543-01 0.05 mg

Recombinant Human PSMC3IP

Ask
View Details
Recombinant Human PSMC3IP
MBS7614543-02 0.2 mg

Recombinant Human PSMC3IP

Ask
View Details