Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-17RD, Mouse (HEK293, His)

Interleukin-17 receptor D (IL-17RD) also known as Sef (similar expression to fibroblast growth factor), is a type I transmembrane protein that can regulate several signaling pathways. Within the cell, IL-17RD expression has been localized mainly to the plasma membrane. IL-17RD is a feedback inhibitor of fibroblast growth factor (FGF) signaling[1]. IL-17RD Protein, Mouse (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags.

Product Specifications

Product Name Alternative

IL-17RD Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-17rd-protein-mouse-hek293-his.html

Smiles

CLNGSQLAVAAGGSGRARGADTCGWRGVGPASRNSGLHNITFRYDNCTTYLNPGGKHAIADAQNITISQYACHDQVAVTILWSPGALGIEFLKGFRVILEELKSEGRQCQQLILKDPKQLNSSFRRTGMESQPFLNMKFETDYFVKIVPFPSIKNESNYHPFFFRTRACDLLLQPDNLACKPFWKPRNLNISQHGSDMHVSFDHAPQNFGFRGFHVLYKLKHEGPFRRRTCRQDQNTETTSCLLQNVSPGDYIIELVDDSNTTRKAAQYVVKSVQSPWAGPIR

Molecular Formula

171463 (Gene_ID) Q8JZL1-1 (C17-R299) (Accession)

Molecular Weight

Approximately 40-65 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Shivangi Pande, et al. Interleukin-17 receptor D (Sef) is a multi-functional regulator of cell signaling. Cell Commun Signal. 2021 Jan 12;19 (1) :6.|[2]Mark Mellett, et al. Orphan receptor IL-17RD regulates Toll-like receptor signalling via SEFIR/TIR interactions. Nat Commun. 2015 Mar 26;6:6669.|[3]Sihan Liu, et al. A shedding soluble form of interleukin-17 receptor D exacerbates collagen-induced arthritis through facilitating TNF-α-dependent receptor clustering. Cell Mol Immunol. 2021 Aug;18 (8) :1883-1895.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATF2 Rabbit Polyclonal Antibody (FITC)
orb2135518 100 µL

ATF2 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
C6orf27 siRNA Oligos set (Human)
53838171 3x 5 nmol

C6orf27 siRNA Oligos set (Human)

Sign In for Pricing
View Details
NCRNA00171 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1405707 1.0 µg DNA

NCRNA00171 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
FLI1 Recombinant Antibody, PE-Cy7 Conjugated
bsm-60431R-PE-Cy7 100 µL

FLI1 Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Efem/EfeO family lipoprotein (SAB0293)
MBS1436112-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus Efem/EfeO family lipoprotein (SAB0293)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Efem/EfeO family lipoprotein (SAB0293)
MBS1436112-02 0.02 mg (Yeast)

Recombinant Staphylococcus aureus Efem/EfeO family lipoprotein (SAB0293)

Sign In for Pricing
View Details