Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Collagen alpha-2 (VI) chain (COL6A2), partial

Product Specifications

Abbreviation

Recombinant Human COL6A2 protein, partial

Gene Name

COL6A2

UniProt

P12110

Expression Region

254-400aa

Organism

Homo sapiens (Human)

Target Sequence

IPGPSGPKGYRGQKGAKGNMGEPGEPGQKGRQGDPGIEGPIGFPGPKGVPGFKGEKGEFGADGRKGAPGLAGKNGTDGQKGKLGRIGPPGCKGDPGNRGPDGYPGEAGSPGERGDQGGKGDPGRPGRRGPPGEIGAKGSKGYQGNSG

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Collagen VI acts as a cell-binding protein.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

35.2 kDa

References & Citations

"Further characterization of the three polypeptide chains of bovine and human short-chain collagen (intima collagen) ." Jander R., Rauterberg J., Glanville R.W. Eur. J. Biochem. 133:39-46 (1983)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial of Isoform 2C2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Loxoprofen Sodium (Mixture of diastereomers)
TRC-L472900-25MG 25 mg

Loxoprofen Sodium (Mixture of diastereomers)

Sign In for Pricing
View Details
MRPL20 Polyclonal Antibody
E-AB-18777-01 20 µL

MRPL20 Polyclonal Antibody

Sign In for Pricing
View Details
MRPL20 Polyclonal Antibody
E-AB-18777-02 60 µL

MRPL20 Polyclonal Antibody

Sign In for Pricing
View Details
MRPL20 Polyclonal Antibody
E-AB-18777-03 120 µL

MRPL20 Polyclonal Antibody

Sign In for Pricing
View Details
MRPL20 Polyclonal Antibody
E-AB-18777-04 200 µL

MRPL20 Polyclonal Antibody

Sign In for Pricing
View Details
Cathepsin B Polyclonal Antibody
E-AB-10208-01 20 µL

Cathepsin B Polyclonal Antibody

Sign In for Pricing
View Details