Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD299, Human (HEK293, hFc)

The CD299 protein is an important C-type lectin that plays a role in cell adhesion and pathogen recognition. It can identify pathogens such as Mycobacterium tuberculosis, Ebola virus, hepatitis C, HIV-1, influenza A, West Nile virus and SARS-CoV. CD299 Protein, Human (HEK293, Fc) is the recombinant human-derived CD299 protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

CD299 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd299-protein-human-hek293-hfc.html

Purity

90.10

Smiles

SLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE

Molecular Formula

10332 (Gene_ID) Q9H2X3-1/NP_055072.3 (S78-E399) (Accession)

Molecular Weight

Approximately 65-77 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPBP1, NT (HSPBP1, HSPBP, Hsp70-binding protein 1, Heat shock protein-binding protein 1, Hsp70-binding protein 2, Hsp70-interacting protein 1, Hsp70-interacting protein 2) (Azide free) (HRP) discontinued
036809-HRP 200 µL

HSPBP1, NT (HSPBP1, HSPBP, Hsp70-binding protein 1, Heat shock protein-binding protein 1, Hsp70-binding protein 2, Hsp70-interacting protein 1, Hsp70-interacting protein 2) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
CD2 (E Rosette Receptor, T11, Lymphocyte Function Antigen 2, LFA-2, Sheep Erythrocyte Receptor) (Biotin)
MBS6248560-01 0.1 mL

CD2 (E Rosette Receptor, T11, Lymphocyte Function Antigen 2, LFA-2, Sheep Erythrocyte Receptor) (Biotin)

Sign In for Pricing
View Details
CD2 (E Rosette Receptor, T11, Lymphocyte Function Antigen 2, LFA-2, Sheep Erythrocyte Receptor) (Biotin)
MBS6248560-02 5x 0.1 mL

CD2 (E Rosette Receptor, T11, Lymphocyte Function Antigen 2, LFA-2, Sheep Erythrocyte Receptor) (Biotin)

Sign In for Pricing
View Details
ATP1B1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV654034 1.0 µg DNA

ATP1B1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
P115 (H-11) Alexa Fluor® 488
sc-48363 AF488 200 µg/mL

P115 (H-11) Alexa Fluor® 488

Sign In for Pricing
View Details
Compound STOCK1N-66631
MBS5792292 Inquire

Compound STOCK1N-66631

Sign In for Pricing
View Details