FGL1, Human (HEK293, mFc)
FGL1 protein is the main ligand of LAG3 and can inhibit antigen-specific T cell activation, mediating the inhibitory function of LAG3 independently of MHC-II binding. FGL1 is secreted by liver cells and contributes to their growth. FGL1 Protein, Human (HEK293, mFc) is the recombinant human-derived FGL1 protein, expressed by HEK293 , with C-mFc labeled tag.
Product Specifications
Product Name Alternative
FGL1 Protein, Human (HEK293, mFc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/fgl1-protein-human-hek293-mfc.html
Purity
99.18
Smiles
LEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI
Molecular Formula
2267 (Gene_ID) Q08830 (L23-I312) (Accession)
Molecular Weight
Approximately 58-68 kDa due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
RPU54646-01 50 µg
Recombinant Rat Linker For Activation Of T-Cell (LAT)
Sign In for Pricing
View Details 
RPU54646-02 100 µg
Recombinant Rat Linker For Activation Of T-Cell (LAT)
Sign In for Pricing
View Details RPU54646-03 1 mg
Recombinant Rat Linker For Activation Of T-Cell (LAT)
Sign In for Pricing
View Details 
MBS6291314-01 0.2 mL
DDO, ID (DDO, D-aspartate oxidase) (Azide free) (HRP)
Sign In for Pricing
View Details