FGL1, Human (HEK293, mFc)
FGL1 protein is the main ligand of LAG3 and can inhibit antigen-specific T cell activation, mediating the inhibitory function of LAG3 independently of MHC-II binding. FGL1 is secreted by liver cells and contributes to their growth. FGL1 Protein, Human (HEK293, mFc) is the recombinant human-derived FGL1 protein, expressed by HEK293 , with C-mFc labeled tag.
Product Specifications
Product Name Alternative
FGL1 Protein, Human (HEK293, mFc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/fgl1-protein-human-hek293-mfc.html
Purity
99.18
Smiles
LEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI
Molecular Formula
2267 (Gene_ID) Q08830 (L23-I312) (Accession)
Molecular Weight
Approximately 58-68 kDa due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7177881 Inquire
Rabbit anti-Escherichia coli O45:K1 (strain S88/ExPEC) ARGB Polyclonal Antibody
Sign In for Pricing
View Details ![FGFR2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F8]](https://cdn.genprice.uk/products/937/6868c334994c49e6dc3f1e32/imageurl/ta502799bm.webp)
TA502799BM 100 µL
FGFR2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F8]
Sign In for Pricing
View Details MBS6145424-01 0.1 mL
GTF3A (Transcription Factor IIIA, General Transcription Factor IIIA, AP2, TFIIIA) (Biotin)
Sign In for Pricing
View Details MBS6145424-02 5x 0.1 mL
GTF3A (Transcription Factor IIIA, General Transcription Factor IIIA, AP2, TFIIIA) (Biotin)
Sign In for Pricing
View Details