Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGL1, Human (HEK293, mFc)

FGL1 protein is the main ligand of LAG3 and can inhibit antigen-specific T cell activation, mediating the inhibitory function of LAG3 independently of MHC-II binding. FGL1 is secreted by liver cells and contributes to their growth. FGL1 Protein, Human (HEK293, mFc) is the recombinant human-derived FGL1 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

FGL1 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgl1-protein-human-hek293-mfc.html

Purity

99.18

Smiles

LEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI

Molecular Formula

2267 (Gene_ID) Q08830 (L23-I312) (Accession)

Molecular Weight

Approximately 58-68 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD112 (Poliovirus Receptor Related 2, PRR2) (MaxLight 650)
C2447-35-ML650 100 µL

CD112 (Poliovirus Receptor Related 2, PRR2) (MaxLight 650)

Sign In for Pricing
View Details
Rin2 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6397603 1.0 µg DNA

Rin2 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Rabbit Polyclonal PODNL1 Antibody
NBP3-05990-100ul 100 µL

Rabbit Polyclonal PODNL1 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Hexosaminidase A/HEXA Antibody (20F1) [Alexa Fluor 750]
NBP2-42629AF750 100 µL

Mouse Monoclonal Hexosaminidase A/HEXA Antibody (20F1) [Alexa Fluor 750]

Sign In for Pricing
View Details
Recombinant Human ABCA7 Protein, N-His
YHK65401 100 μg

Recombinant Human ABCA7 Protein, N-His

Sign In for Pricing
View Details
Serine Protease 1 (PRSS1) Antibody (HRP)
abx319686-01 20 µg

Serine Protease 1 (PRSS1) Antibody (HRP)

Sign In for Pricing
View Details