FGL1, Human (HEK293, mFc)
FGL1 protein is the main ligand of LAG3 and can inhibit antigen-specific T cell activation, mediating the inhibitory function of LAG3 independently of MHC-II binding. FGL1 is secreted by liver cells and contributes to their growth. FGL1 Protein, Human (HEK293, mFc) is the recombinant human-derived FGL1 protein, expressed by HEK293 , with C-mFc labeled tag.
Product Specifications
Product Name Alternative
FGL1 Protein, Human (HEK293, mFc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/fgl1-protein-human-hek293-mfc.html
Purity
99.18
Smiles
LEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI
Molecular Formula
2267 (Gene_ID) Q08830 (L23-I312) (Accession)
Molecular Weight
Approximately 58-68 kDa due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
B0807-09T4-Biotin 100 µL
Bcl 2 Inhibitor of Transcription 1 (Bit1, Peptidyl-tRNA Hydrolase 2) (Biotin) discontinued
Sign In for Pricing
View Details K1426502 1.0 µg DNA
NHSL2 sgRNA CRISPR Lentivector (Human) (Target 1)
Sign In for Pricing
View Details 303381 100 µg
IKK beta, CT (I kappa B Kinase 2, I kappa B Kinase beta, I-kappa-B Kinase 2, I-kappa-B-kinase beta, IkBKB, IKK 2, IKK B, IKK beta, IKK-B, IKK-beta, IKK2, IKKB, IKKB_HUMAN, Inhibitor of kappa Light Chain Gene Enhancer in B Cells, Inhibitor of kappa Light Polypeptide Gene Enhancer in B Cells, Inhibitor of kappa Light Polypeptide Gene Enhancer in B Cells Kinase beta, Inhibitor of kappa Light Polypeptide Gene Enhancer in B Cells Kinase beta, Inhibitor of Nuclear Factor kappa B Kinase beta Subunit, Inhibitor of Nuclear Factor kappa B Kinase Subunit beta, Inhibitor of Nuclear Factor kappa-B Kinase Subunit beta, NFKBIKB, Nuclear Factor NF kappa B Inhibitor Kinase beta, Nuclear Factor NF-kappa-B Inhibitor Kinase beta, Nuclear Factor of kappa Light Chain Gene Enhancer in B Cells Inhibitor)
Sign In for Pricing
View Details