Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGL1, Human (HEK293, mFc)

FGL1 protein is the main ligand of LAG3 and can inhibit antigen-specific T cell activation, mediating the inhibitory function of LAG3 independently of MHC-II binding. FGL1 is secreted by liver cells and contributes to their growth. FGL1 Protein, Human (HEK293, mFc) is the recombinant human-derived FGL1 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

FGL1 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgl1-protein-human-hek293-mfc.html

Purity

99.18

Smiles

LEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI

Molecular Formula

2267 (Gene_ID) Q08830 (L23-I312) (Accession)

Molecular Weight

Approximately 58-68 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal CAMK2D Antibody (monoclonal) (M02), Clone: 1A8
APG02340G 0.1mg

Monoclonal CAMK2D Antibody (monoclonal) (M02), Clone: 1A8

Sign In for Pricing
View Details
HSP-60/HSPD1 (Heat Shock Protein 60) Porcine ELISA Kit
E1338 96 Tests

HSP-60/HSPD1 (Heat Shock Protein 60) Porcine ELISA Kit

Sign In for Pricing
View Details
Anti-GPR45 antibody
STJ118249 100 µl

Anti-GPR45 antibody

Sign In for Pricing
View Details
REREP2Y 3'UTR GFP Stable Cell Line
TU069760 1.0 mL

REREP2Y 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Tris Buffer 0.5M, pH 9.0
42020361-3 4 L

Tris Buffer 0.5M, pH 9.0

Sign In for Pricing
View Details
CDK2AP1 Protein Vector (Human) (pPB-N-His)
PV008818 500 ng

CDK2AP1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details