Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGL1, Human (HEK293, mFc)

FGL1 protein is the main ligand of LAG3 and can inhibit antigen-specific T cell activation, mediating the inhibitory function of LAG3 independently of MHC-II binding. FGL1 is secreted by liver cells and contributes to their growth. FGL1 Protein, Human (HEK293, mFc) is the recombinant human-derived FGL1 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

FGL1 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgl1-protein-human-hek293-mfc.html

Purity

99.18

Smiles

LEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI

Molecular Formula

2267 (Gene_ID) Q08830 (L23-I312) (Accession)

Molecular Weight

Approximately 58-68 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adelmidrol
C11999 25 mg

Adelmidrol

Sign In for Pricing
View Details
JNK1 Recombinant Rabbit mAb
E43S46477 100 µL

JNK1 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Human HEXa (Hexosaminidase A Alpha) ELISA Kit
ELK3577-01 48 Tests

Human HEXa (Hexosaminidase A Alpha) ELISA Kit

Sign In for Pricing
View Details
Human HEXa (Hexosaminidase A Alpha) ELISA Kit
ELK3577-02 96 Tests

Human HEXa (Hexosaminidase A Alpha) ELISA Kit

Sign In for Pricing
View Details
Human HEXa (Hexosaminidase A Alpha) ELISA Kit
ELK3577-03 5x 96 Tests

Human HEXa (Hexosaminidase A Alpha) ELISA Kit

Sign In for Pricing
View Details
Phospho-CDK2 Rabbit Monoclonal Antibody
E56G4221 100 µL

Phospho-CDK2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details