Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGL1, Human (HEK293, mFc)

FGL1 protein is the main ligand of LAG3 and can inhibit antigen-specific T cell activation, mediating the inhibitory function of LAG3 independently of MHC-II binding. FGL1 is secreted by liver cells and contributes to their growth. FGL1 Protein, Human (HEK293, mFc) is the recombinant human-derived FGL1 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

FGL1 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgl1-protein-human-hek293-mfc.html

Purity

99.18

Smiles

LEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI

Molecular Formula

2267 (Gene_ID) Q08830 (L23-I312) (Accession)

Molecular Weight

Approximately 58-68 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclosporin A
BML-A195-0100 100 mg

Cyclosporin A

Sign In for Pricing
View Details
Recombinant Wigglesworthia glossinidia brevipalpis ATP synthase subunit c (atpE), partial
MBS7092913 Inquire

Recombinant Wigglesworthia glossinidia brevipalpis ATP synthase subunit c (atpE), partial

Sign In for Pricing
View Details
TP53I13 Polyclonal Antibody
MBS8570606-01 0.1 mL

TP53I13 Polyclonal Antibody

Sign In for Pricing
View Details
TP53I13 Polyclonal Antibody
MBS8570606-02 0.1 mL (AF405L)

TP53I13 Polyclonal Antibody

Sign In for Pricing
View Details
TP53I13 Polyclonal Antibody
MBS8570606-03 0.1 mL (AF405S)

TP53I13 Polyclonal Antibody

Sign In for Pricing
View Details
TP53I13 Polyclonal Antibody
MBS8570606-04 0.1 mL (AF610)

TP53I13 Polyclonal Antibody

Sign In for Pricing
View Details