Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGL1, Human (HEK293, mFc)

FGL1 protein is the main ligand of LAG3 and can inhibit antigen-specific T cell activation, mediating the inhibitory function of LAG3 independently of MHC-II binding. FGL1 is secreted by liver cells and contributes to their growth. FGL1 Protein, Human (HEK293, mFc) is the recombinant human-derived FGL1 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

FGL1 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgl1-protein-human-hek293-mfc.html

Purity

99.18

Smiles

LEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI

Molecular Formula

2267 (Gene_ID) Q08830 (L23-I312) (Accession)

Molecular Weight

Approximately 58-68 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELP4 (NM_001288725) Human Tagged ORF Clone
RG238450 10 µg

ELP4 (NM_001288725) Human Tagged ORF Clone

Sign In for Pricing
View Details
DNP-PEG3-acid
HY-174937 1 Each

DNP-PEG3-acid

Sign In for Pricing
View Details
Mouse PPM1J shRNA Plasmid
abx977562-01 150 µg

Mouse PPM1J shRNA Plasmid

Sign In for Pricing
View Details
Mouse PPM1J shRNA Plasmid
abx977562-02 300 µg

Mouse PPM1J shRNA Plasmid

Sign In for Pricing
View Details
EPB41L3 Protein Vector (Human) (pPM-C-His)
PV014348 500 ng

EPB41L3 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
OXCT1 Polyclonal Antibody
MBS2541347-01 0.06 mL

OXCT1 Polyclonal Antibody

Sign In for Pricing
View Details