Animal-Free IL-17A, Human (His)
The IL-17A protein is an important effector cytokine that is critical in both innate and adaptive immunity to defend against microorganisms and maintain tissue integrity. It acts through the IL17RA-IL17RC heterodimeric receptor complex, triggering signaling pathways, activating immune-related gene transcription and promoting strong immune inflammation. Animal-Free IL-17A Protein, Human (His) is the recombinant human-derived animal-FreeIL-17A protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free IL-17A Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-il-17a-protein-human-his.html
Purity
95.0
Smiles
MIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Molecular Formula
3605 (Gene_ID) Q16552 (I20-A155) (Accession)
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL
Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL
