Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PD-1, Human (C93S, HEK293, His)

PD-1 protein is an inhibitory receptor on T cells that maintains immune tolerance by binding to CD274/PDCD1L1 and CD273/PDCD1LG2. It blocks T cell activation by binding to CD3-TCR and recruiting PTPN11/SHP-2 to dephosphorylate key signaling molecules. PD-1 Protein, Human (C93S, HEK293, His) is the recombinant human-derived PD-1 protein, expressed by HEK293 , with C-6*His labeled tag and C93S mutation.

Product Specifications

Product Name Alternative

PD-1 Protein, Human (C93S, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pd-1-protein-human-c93s-hek-293-his.html

Purity

95.0

Smiles

LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDSRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQ

Molecular Formula

5133 (Gene_ID) Q15116 (L25-Q167, C93S) (Accession)

Molecular Weight

23-38 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRTAP9-4 sgRNA CRISPR Lentivector (Human) (Target 2)
K1184803 1.0 µg DNA

KRTAP9-4 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Goat Anti-Human Ig Fab-AP
2085-04 1.0 mL

Goat Anti-Human Ig Fab-AP

Sign In for Pricing
View Details
TIMELESS Rabbit Monoclonal Antibody [Clone ID: R01-7H7]
TA422153 100 µL

TIMELESS Rabbit Monoclonal Antibody [Clone ID: R01-7H7]

Sign In for Pricing
View Details
Human XG Pre-designed siRNA Set A
SI018313A 1 Each

Human XG Pre-designed siRNA Set A

Sign In for Pricing
View Details
Amyloid-β Polyclonal Antibody
UB-GEN-12683 100 µL

Amyloid-β Polyclonal Antibody

Sign In for Pricing
View Details
FcRH1 (E-8) : m-IgG2a BP-HRP Bundle
sc-546632 1 Kit

FcRH1 (E-8) : m-IgG2a BP-HRP Bundle

Sign In for Pricing
View Details