Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PD-1, Human (C93S, HEK293, His)

PD-1 protein is an inhibitory receptor on T cells that maintains immune tolerance by binding to CD274/PDCD1L1 and CD273/PDCD1LG2. It blocks T cell activation by binding to CD3-TCR and recruiting PTPN11/SHP-2 to dephosphorylate key signaling molecules. PD-1 Protein, Human (C93S, HEK293, His) is the recombinant human-derived PD-1 protein, expressed by HEK293 , with C-6*His labeled tag and C93S mutation.

Product Specifications

Product Name Alternative

PD-1 Protein, Human (C93S, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pd-1-protein-human-c93s-hek-293-his.html

Purity

95.0

Smiles

LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDSRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQ

Molecular Formula

5133 (Gene_ID) Q15116 (L25-Q167, C93S) (Accession)

Molecular Weight

23-38 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAX1BP1 Recombinant Protein (Rat)
RP232385 100 µg

TAX1BP1 Recombinant Protein (Rat)

Sign In for Pricing
View Details
EYA4, CT (EYA4, Eyes absent homolog 4) (MaxLight 405)
MBS6297256-01 0.1 mL

EYA4, CT (EYA4, Eyes absent homolog 4) (MaxLight 405)

Sign In for Pricing
View Details
EYA4, CT (EYA4, Eyes absent homolog 4) (MaxLight 405)
MBS6297256-02 5x 0.1 mL

EYA4, CT (EYA4, Eyes absent homolog 4) (MaxLight 405)

Sign In for Pricing
View Details
Human Pref-1/DLK1/FA1 Recombinant Protein
PROTP80370-50ug 50 µg

Human Pref-1/DLK1/FA1 Recombinant Protein

Sign In for Pricing
View Details
Bovine Zinc finger protein 135, ZNF135 ELISA KIT
ELI-22606b 96 Tests

Bovine Zinc finger protein 135, ZNF135 ELISA KIT

Sign In for Pricing
View Details
EIF2α (phospho Ser51) rabbit pAb
ES1304-01 50 µL

EIF2α (phospho Ser51) rabbit pAb

Sign In for Pricing
View Details