Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PD-1, Human (C93S, HEK293, His)

PD-1 protein is an inhibitory receptor on T cells that maintains immune tolerance by binding to CD274/PDCD1L1 and CD273/PDCD1LG2. It blocks T cell activation by binding to CD3-TCR and recruiting PTPN11/SHP-2 to dephosphorylate key signaling molecules. PD-1 Protein, Human (C93S, HEK293, His) is the recombinant human-derived PD-1 protein, expressed by HEK293 , with C-6*His labeled tag and C93S mutation.

Product Specifications

Product Name Alternative

PD-1 Protein, Human (C93S, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pd-1-protein-human-c93s-hek-293-his.html

Purity

95.0

Smiles

LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDSRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQ

Molecular Formula

5133 (Gene_ID) Q15116 (L25-Q167, C93S) (Accession)

Molecular Weight

23-38 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (B-B12), CF770 conjugate, 0.1mg/mL
BNC701052-500 1x 500 µL

CD3e (B-B12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF740 conjugate, 0.1mg/mL
BNC740861-500 1x 500 µL

HSP27 (G3.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL
BNC040026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF488A conjugate, 0.1mg/mL
BNC880164-500 1x 500 µL

CD28 (204.12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thyroglobulin (Thyroidal Cell Marker) (rTGB24), CF594 conjugate, 0.1mg/mL
BNC941967-100 1x 100 µL

Thyroglobulin (Thyroidal Cell Marker) (rTGB24), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 6 (MUC6) (MUC6/916), CF647 conjugate, 0.1mg/mL
BNC470916-500 1x 500 µL

Mucin 6 (MUC6) (MUC6/916), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details