Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PD-1, Human (C93S, HEK293, His)

PD-1 protein is an inhibitory receptor on T cells that maintains immune tolerance by binding to CD274/PDCD1L1 and CD273/PDCD1LG2. It blocks T cell activation by binding to CD3-TCR and recruiting PTPN11/SHP-2 to dephosphorylate key signaling molecules. PD-1 Protein, Human (C93S, HEK293, His) is the recombinant human-derived PD-1 protein, expressed by HEK293 , with C-6*His labeled tag and C93S mutation.

Product Specifications

Product Name Alternative

PD-1 Protein, Human (C93S, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pd-1-protein-human-c93s-hek-293-his.html

Purity

95.0

Smiles

LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDSRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQ

Molecular Formula

5133 (Gene_ID) Q15116 (L25-Q167, C93S) (Accession)

Molecular Weight

23-38 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Defensin Beta 103A (DEFB103A) Antibody
abx430848 200 µL

Defensin Beta 103A (DEFB103A) Antibody

Sign In for Pricing
View Details
Mmu-miR-1839-3p miRNA Mimic
CMM0656-01 5 nmol

Mmu-miR-1839-3p miRNA Mimic

Sign In for Pricing
View Details
Mmu-miR-1839-3p miRNA Mimic
CMM0656-02 10 nmol

Mmu-miR-1839-3p miRNA Mimic

Sign In for Pricing
View Details
ANTR2 Antibody
PHY1018A 150 μg

ANTR2 Antibody

Sign In for Pricing
View Details
RARS Antibody
MBS8593663-01 0.1 mg

RARS Antibody

Sign In for Pricing
View Details
RARS Antibody
MBS8593663-02 0.1 mL (AF405L)

RARS Antibody

Sign In for Pricing
View Details