PD-1, Human (C93S, HEK293, His)
PD-1 protein is an inhibitory receptor on T cells that maintains immune tolerance by binding to CD274/PDCD1L1 and CD273/PDCD1LG2. It blocks T cell activation by binding to CD3-TCR and recruiting PTPN11/SHP-2 to dephosphorylate key signaling molecules. PD-1 Protein, Human (C93S, HEK293, His) is the recombinant human-derived PD-1 protein, expressed by HEK293 , with C-6*His labeled tag and C93S mutation.
Product Specifications
Product Name Alternative
PD-1 Protein, Human (C93S, HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/pd-1-protein-human-c93s-hek-293-his.html
Purity
95.0
Smiles
LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDSRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQ
Molecular Formula
5133 (Gene_ID) Q15116 (L25-Q167, C93S) (Accession)
Molecular Weight
23-38 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
MAP1LC3C (APG8C) (T48) (LC3, MAP1LC3C, Microtubule-associated proteins 1A/1B light chain 3C, Autophagy-related protein LC3 C, Autophagy-related ubiquitin-like modifier LC3 C, MAP1 light chain 3-like protein 3, MAP1A/MAP1B light chain 3 C, Microtubule-associated protein 1 light chain 3 gamma) (Azide free) (HRP) discontinued
