Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PD-1, Human (C93S, HEK293, His)

PD-1 protein is an inhibitory receptor on T cells that maintains immune tolerance by binding to CD274/PDCD1L1 and CD273/PDCD1LG2. It blocks T cell activation by binding to CD3-TCR and recruiting PTPN11/SHP-2 to dephosphorylate key signaling molecules. PD-1 Protein, Human (C93S, HEK293, His) is the recombinant human-derived PD-1 protein, expressed by HEK293 , with C-6*His labeled tag and C93S mutation.

Product Specifications

Product Name Alternative

PD-1 Protein, Human (C93S, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pd-1-protein-human-c93s-hek-293-his.html

Purity

95.0

Smiles

LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDSRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQ

Molecular Formula

5133 (Gene_ID) Q15116 (L25-Q167, C93S) (Accession)

Molecular Weight

23-38 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP1LC3C (APG8C) (T48) (LC3, MAP1LC3C, Microtubule-associated proteins 1A/1B light chain 3C, Autophagy-related protein LC3 C, Autophagy-related ubiquitin-like modifier LC3 C, MAP1 light chain 3-like protein 3, MAP1A/MAP1B light chain 3 C, Microtubule-associated protein 1 light chain 3 gamma) (Azide free) (HRP) discontinued
038116-HRP 200 µL

MAP1LC3C (APG8C) (T48) (LC3, MAP1LC3C, Microtubule-associated proteins 1A/1B light chain 3C, Autophagy-related protein LC3 C, Autophagy-related ubiquitin-like modifier LC3 C, MAP1 light chain 3-like protein 3, MAP1A/MAP1B light chain 3 C, Microtubule-associated protein 1 light chain 3 gamma) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Horse Complement Component 4 ELISA Kit
MBS072832-01 48 Well

Horse Complement Component 4 ELISA Kit

Sign In for Pricing
View Details
Horse Complement Component 4 ELISA Kit
MBS072832-02 96 Well

Horse Complement Component 4 ELISA Kit

Sign In for Pricing
View Details
Horse Complement Component 4 ELISA Kit
MBS072832-03 5x 96 Well

Horse Complement Component 4 ELISA Kit

Sign In for Pricing
View Details
Horse Complement Component 4 ELISA Kit
MBS072832-04 10x 96 Well

Horse Complement Component 4 ELISA Kit

Sign In for Pricing
View Details
APC1 Polyclonal Antibody
JOT-AP00508-01 50ul

APC1 Polyclonal Antibody

Sign In for Pricing
View Details