Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Interleukin-23 subunit alpha (IL23A) ELISA kit

Product Specifications

CAS Number

7732-18-5

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSRP1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV674756 1.0 µg DNA

CSRP1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Cyclin B1 Rabbit pAb
E47R23016 100 µL

Cyclin B1 Rabbit pAb

Sign In for Pricing
View Details
Recombinant e.coli glpK protein
ATGP3062-020 20 µg

Recombinant e.coli glpK protein

Sign In for Pricing
View Details
WZ811 25mg
A12588-25 25 mg

WZ811 25mg

Sign In for Pricing
View Details
Rabbit Polyclonal THOC7 Antibody
NBP3-30671 100 µg

Rabbit Polyclonal THOC7 Antibody

Sign In for Pricing
View Details
H-FTLIELLIVVAIIGILAAIAIPQFSAYRVKAYNSAASSDLRNLKTALESAFADDQTYPPES-OH
PP49310-01 1 mg

H-FTLIELLIVVAIIGILAAIAIPQFSAYRVKAYNSAASSDLRNLKTALESAFADDQTYPPES-OH

Sign In for Pricing
View Details