Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-DPB1, Human (His)

Product Specifications

Product Name Alternative

HLA-DPB1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hla-dpb1-protein-human-his.html

Purity

90.00

Smiles

RATPENYLFQGRQECYAFNGTQRFLERYIYNREEFARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSAR

Molecular Formula

3115 (Gene_ID) P04440 (R30-R223) (Accession)

Molecular Weight

Approximately 26.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Monoclonal Antibody to Human IgG4 RJ4,  15nm
GM-207-15 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human IgG4 RJ4, 15nm

Sign In for Pricing
View Details
Biotin Anti-Human CD86 Antibody[BU63]
E-AB-F1012B-01 25 µg

Biotin Anti-Human CD86 Antibody[BU63]

Sign In for Pricing
View Details
Biotin Anti-Human CD86 Antibody[BU63]
E-AB-F1012B-02 100 µg

Biotin Anti-Human CD86 Antibody[BU63]

Sign In for Pricing
View Details
N-tert-Butoxycarbonyl Tyramine
TRC-B690580-2G 2 g

N-tert-Butoxycarbonyl Tyramine

Sign In for Pricing
View Details
FH Antibody
KC-1940-01 50 μL

FH Antibody

Sign In for Pricing
View Details
FH Antibody
KC-1940-02 100 µL

FH Antibody

Sign In for Pricing
View Details