Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-DPB1, Human (His)

Product Specifications

Product Name Alternative

HLA-DPB1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hla-dpb1-protein-human-his.html

Purity

90.00

Smiles

RATPENYLFQGRQECYAFNGTQRFLERYIYNREEFARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSAR

Molecular Formula

3115 (Gene_ID) P04440 (R30-R223) (Accession)

Molecular Weight

Approximately 26.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lymphocyte Activation Gene 3 (LAG3) Mouse Monoclonal Antibody [Clone ID: OTI8G6]
CF807180 100 µg

Lymphocyte Activation Gene 3 (LAG3) Mouse Monoclonal Antibody [Clone ID: OTI8G6]

Sign In for Pricing
View Details
Thrombomodulin / CD141 (Endothelial Cell Marker) (rTHBD/1591), 1mg/mL
BNUM2332-50 1x 50 µL

Thrombomodulin / CD141 (Endothelial Cell Marker) (rTHBD/1591), 1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: left
CR562475 5 µg

Tissue Total RNA, Ovary: left

Sign In for Pricing
View Details
Ganglioside GM1 Sodium Salt (bovine brain)
TRC-G235068-25MG 25 mg

Ganglioside GM1 Sodium Salt (bovine brain)

Sign In for Pricing
View Details
Zilpaterol
TRC-Z430000-10MG 10 mg

Zilpaterol

Sign In for Pricing
View Details
Syntenin (SDCBP) (NM_001007068) Human Recombinant Protein
TP315442 20 µg

Syntenin (SDCBP) (NM_001007068) Human Recombinant Protein

Sign In for Pricing
View Details