Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-DPB1, Human (His)

Product Specifications

Product Name Alternative

HLA-DPB1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hla-dpb1-protein-human-his.html

Purity

90.00

Smiles

RATPENYLFQGRQECYAFNGTQRFLERYIYNREEFARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSAR

Molecular Formula

3115 (Gene_ID) P04440 (R30-R223) (Accession)

Molecular Weight

Approximately 26.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lanreotide Acetate
TRC-L174600-25MG 25 mg

Lanreotide Acetate

Sign In for Pricing
View Details
Tissue Total RNA, Brain
CR559668 5 µg

Tissue Total RNA, Brain

Sign In for Pricing
View Details
IL 17B Human
OM296688-01 25 µg

IL 17B Human

Sign In for Pricing
View Details
IL 17B Human
OM296688-02 5 µg

IL 17B Human

Sign In for Pricing
View Details
IL 17B Human
OM296688-03 1 mg

IL 17B Human

Sign In for Pricing
View Details
Histone H2A.x Rabbit Polyclonal Antibody
ER1901-70 100 µL

Histone H2A.x Rabbit Polyclonal Antibody

Sign In for Pricing
View Details