Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SDF-1 alpha/CXCL12, Human

SDF-1 alpha (CXCL12α) belongs to the CXC chemokine family and is encoded by the CXCL12 gene. SDF-1 alpha mediates cell chemotaxis and tissue repair through CXCR4/CXCR7, activates AMPK to inhibit NLRP3 inflammasome and pyroptosis; SDF-1 alpha promotes autophagy through the PI3K-mTOR pathway, is induced by upstream inflammatory factors such as TNF-α, and recruits integrins downstream to promote cell adhesion[1]. SDF-1 alpha/CXCL12 Protein, Human is the recombinant human-derived SDF-1 alpha/CXCL12 protein, expressed by E. coli, with tag free.

Product Specifications

Product Name Alternative

SDF-1 alpha/CXCL12 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sdf-1-alpha-cxcl12-protein-human.html

Purity

98.0

Smiles

KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK

Molecular Formula

6387 (Gene_ID) P48061-2 (K22-K89) (Accession)

Molecular Weight

Approximately 8 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[5]Hoh BL, et al. Stromal cell-derived factor-1 promoted angiogenesis and inflammatory cell infiltration in aneurysm walls. J Neurosurg. 2014 Jan;120 (1) :73-86.|[1]Wang S, et al. Exogenous stromal cell-derived factor-1 (SDF-1) suppresses the NLRP3 inflammasome and inhibits pyroptosis in synoviocytes from osteoarthritic joints via activation of the AMPK signaling pathway. Inflammopharmacology. 2021 Jun;29 (3) :695-704.|[2]Hayakawa J, et al. Dextran sulfate and stromal cell derived factor-1 promote CXCR4 expression and improve bone marrow homing efficiency of infused hematopoietic stem cells. J Nippon Med Sch. 2009 Aug;76 (4) :198-208.|[3]Warner JA, et al. Human cytomegalovirus infection inhibits CXCL12- mediated migration and invasion of human extravillous cytotrophoblasts. Virol J. 2012 Nov 1;9:255.|[4]Yadav SS, et al. CXCL12 is a key regulator in tumor microenvironment of cervical cancer: an in vitro study. Clin Exp Metastasis. 2016 Jun;33 (5) :431-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM38 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI113D3]
TA505981BM 100 µL

TRIM38 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI113D3]

Sign In for Pricing
View Details
PCNP Polyclonal Antibody
E-AB-90836-01 60 µL

PCNP Polyclonal Antibody

Sign In for Pricing
View Details
PCNP Polyclonal Antibody
E-AB-90836-02 120 µL

PCNP Polyclonal Antibody

Sign In for Pricing
View Details
PCNP Polyclonal Antibody
E-AB-90836-03 200 µL

PCNP Polyclonal Antibody

Sign In for Pricing
View Details
Vasopressin V1b receptor (AVPR1B) Rabbit Polyclonal Antibody
TA372088 100 µL

Vasopressin V1b receptor (AVPR1B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BMP-7 Polyclonal Antibody
E-AB-40594-01 25 µL

BMP-7 Polyclonal Antibody

Sign In for Pricing
View Details