KGF/FGF-7, Human (N-His)
KGF/FGF-7 Protein, Human (His) is a polypeptide mitogen that belongs to the family of fibroblast growth factors, binds only to a splice variant of FGFR2 (FGFR2 IIIb) and is a highly specific paracrine growth factor for epithelial cells. KGF/FGF-7 Protein, Human (His) and its receptor are important for normal wound healing.
Product Specifications
Product Name Alternative
KGF/FGF-7 Protein, Human (N-His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/kgf-fgf-7-protein-human-his.html
Purity
96.00
Smiles
CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
Molecular Formula
2252 (Gene_ID) P21781-1 (C32-T194) (Accession)
Molecular Weight
Approximately 23 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Trowbridge JM, et al. Dermatan sulfate binds and potentiates activity of keratinocyte growth factor (FGF-7) . J Biol Chem. 2002 Nov 8;277 (45) :42815-20.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740096-100 1x 100 µL
Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940181-100 1x 100 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940633-100 1x 100 µL
Von Willebrand Factor (3E2D10), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740178-500 1x 500 µL
CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 