Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Ferrichrome-iron receptor (fhuA), partial

Product Specifications

Product Name Alternative

Ferric hydroxamate receptor; Ferric hydroxamate uptake; Ferrichrome-iron receptor

Abbreviation

Recombinant E.coli fhuA protein, partial

Gene Name

FhuA

UniProt

P06971

Expression Region

269-387aa

Organism

Escherichia coli (strain K12)

Target Sequence

QNEPETGYYGWLPKEGTVEPLPNGKRLPTDFNEGAKNNTYSRNEKMVGYSFDHEFNDTFTVRQNLRFAENKTSQNSVYGYGVCSDPANAYSKQCAALAPADKGHYLARKYVVDDEKLQN

Tag

N-terminal 6xHis-Trx-tagged

Type

Transmembrane Protein & In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Involved in the uptake of iron in complex with ferrichrome, a hydroxamate-type siderophore. Binds and transports ferrichrome-iron across the outer membrane. In addition to its role in ferrichrome-iron transport, transports the antibiotic albomycin, which is a structural analog of ferrichrome, and acts as a receptor for colicin M, microcin J25 and bacteriophages T1, T5, phi80 and UC-1. The energy source, which is required for all FhuA functions except infection by phage T5, is provided by the inner membrane TonB system.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

31.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LNP (LNPK) CytoSection
TS413378P5 25 Slides

LNP (LNPK) CytoSection

Sign In for Pricing
View Details
Transketolase (CT) Polyclonal Antibody, PerCP Conjugated
bs-4514R-PerCP 100 µL

Transketolase (CT) Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Ctnna3 (NM_177612) Mouse Tagged ORF Clone
MG216005 10 µg

Ctnna3 (NM_177612) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal SFRS12 Antibody
NBP3-35325-100ul 100 µL

Rabbit Polyclonal SFRS12 Antibody

Sign In for Pricing
View Details
Tgfbr1 (NM_009370) Mouse Tagged ORF Clone Lentiviral Particle
MR208091L3V 200 µL

Tgfbr1 (NM_009370) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Porcine Follicle Stimulating Hormone (FSH) ELISA Kit
RDR-FSH-p-48Tests 48 Tests

Porcine Follicle Stimulating Hormone (FSH) ELISA Kit

Sign In for Pricing
View Details