Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD276/B7-H3, Rat (HEK293, His)

CD276/B7-H3 Protein regulates T-cell-mediated immune responses and transplant rejection. It also promotes bone formation, functioning at the bone-immune interface. Additionally, it activates immune responses against tumors, eliminating them through natural killer cells and CD8 T-cells. Its interaction with TREML2 enhances T-cell activation, highlighting its role in immune regulation. CD276/B7-H3 Protein, Rat (HEK293, His) is the recombinant rat-derived CD276/B7-H3 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD276/B7-H3 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd276-b7-h3-protein-rat-hek293-his.html

Purity

97.00

Smiles

VEVQVSEDPVVALVDTDATLRCSFSPEPGFSLRQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGDMVTITCSSYQGYPEAEVFWKDGQGLPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTF

Molecular Formula

315716 (Gene_ID) Q7TPB4 (V29-F244) (Accession)

Molecular Weight

Approximately 34-43 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC2 (CCP58), CF488A conjugate, 0.1mg/mL
BNC880032-500 1x 500 µL

MUC2 (CCP58), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL
BNC680525-500 1x 500 µL

CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL
BNC680994-500 1x 500 µL

TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL
BNC680034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Moesin (MSN/493), CF568 conjugate, 0.1mg/mL
BNC680493-500 1x 500 µL

Moesin (MSN/493), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD163 (Monocyte & Macrophage Marker) (M130/1210), CF647 conjugate, 0.1mg/mL
BNC471210-100 1x 100 µL

CD163 (Monocyte & Macrophage Marker) (M130/1210), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details