Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free AGER, Human (His)

AGER proteins are cell surface pattern recognition receptors that expertly sense endogenous stress signals utilizing an extensive library of ligands, including advanced glycation end products, S100 proteins, high mobility Group Box 1 proteins/HMGB1, starch Like protein β/APP oligomers, nucleic acids, phospholipids, and glycosaminoglycans. Animal-Free AGER Protein, Human (His) is the recombinant human-derived animal-FreeAGER protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free AGER Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ager-protein-human-his.html

Purity

95.00

Smiles

MAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYS

Molecular Formula

177 (Gene_ID) Q15109 (A23-S300) (Accession)

Molecular Weight

Approximately 30.94 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone cluster 2 H2AC CRISPR/Cas9 KO Plasmid (h)
sc-411141 20 µg

Histone cluster 2 H2AC CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Mouse Monoclonal GIPR Antibody (591816) [Allophycocyanin/Cy7]
MAB82101APCCY7 0.1 mL

Mouse Monoclonal GIPR Antibody (591816) [Allophycocyanin/Cy7]

Sign In for Pricing
View Details
COX10 Rabbit pAb
E47R23098 100 µL

COX10 Rabbit pAb

Sign In for Pricing
View Details
Atg13 (NM_145528) Mouse Tagged ORF Clone
MR207683 10 µg

Atg13 (NM_145528) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CD24 Protein, Mouse, Recombinant (hFc Tag)
MBS8122943-01 0.1 mg

CD24 Protein, Mouse, Recombinant (hFc Tag)

Sign In for Pricing
View Details
CD24 Protein, Mouse, Recombinant (hFc Tag)
MBS8122943-02 1 mg

CD24 Protein, Mouse, Recombinant (hFc Tag)

Sign In for Pricing
View Details