Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free AGER, Human (His)

AGER proteins are cell surface pattern recognition receptors that expertly sense endogenous stress signals utilizing an extensive library of ligands, including advanced glycation end products, S100 proteins, high mobility Group Box 1 proteins/HMGB1, starch Like protein β/APP oligomers, nucleic acids, phospholipids, and glycosaminoglycans. Animal-Free AGER Protein, Human (His) is the recombinant human-derived animal-FreeAGER protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free AGER Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ager-protein-human-his.html

Purity

95.00

Smiles

MAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYS

Molecular Formula

177 (Gene_ID) Q15109 (A23-S300) (Accession)

Molecular Weight

Approximately 30.94 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMARCA5 (SWI/SNF-related Matrix-associated Actin-dependent Regulator of Chromatin Subfamily A Member 5, SWI/SNF-related Matrix-associated Actin-dependent Regulator of Chromatin A5, Sucrose Nonfermenting Protein 2 Homolog, hSNF2H, SNF2H, WCRF135)
133553 100 µg

SMARCA5 (SWI/SNF-related Matrix-associated Actin-dependent Regulator of Chromatin Subfamily A Member 5, SWI/SNF-related Matrix-associated Actin-dependent Regulator of Chromatin A5, Sucrose Nonfermenting Protein 2 Homolog, hSNF2H, SNF2H, WCRF135)

Sign In for Pricing
View Details
IP-10
321008-01 50 µg

IP-10

Sign In for Pricing
View Details
IP-10
321008-02 100 µg

IP-10

Sign In for Pricing
View Details
CCND2 (Cyclin D2, KIAK0002, MGC102758) (MaxLight 750)
MBS6409972-01 0.1 mL

CCND2 (Cyclin D2, KIAK0002, MGC102758) (MaxLight 750)

Sign In for Pricing
View Details
CCND2 (Cyclin D2, KIAK0002, MGC102758) (MaxLight 750)
MBS6409972-02 5x 0.1 mL

CCND2 (Cyclin D2, KIAK0002, MGC102758) (MaxLight 750)

Sign In for Pricing
View Details
Mouse Monoclonal Myc Epitope Tag Antibody (AT19B4) [FITC]
NBP2-50582F 100 µL

Mouse Monoclonal Myc Epitope Tag Antibody (AT19B4) [FITC]

Sign In for Pricing
View Details