Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free AGER, Human (His)

AGER proteins are cell surface pattern recognition receptors that expertly sense endogenous stress signals utilizing an extensive library of ligands, including advanced glycation end products, S100 proteins, high mobility Group Box 1 proteins/HMGB1, starch Like protein β/APP oligomers, nucleic acids, phospholipids, and glycosaminoglycans. Animal-Free AGER Protein, Human (His) is the recombinant human-derived animal-FreeAGER protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free AGER Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ager-protein-human-his.html

Purity

95.00

Smiles

MAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYS

Molecular Formula

177 (Gene_ID) Q15109 (A23-S300) (Accession)

Molecular Weight

Approximately 30.94 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wdr41 Mouse Gene Knockout Kit (CRISPR)
KN519358 1 Kit

Wdr41 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FAM53B (NM_014661) Human Tagged ORF Clone Lentiviral Particle
RC212696L4V 200 µL

FAM53B (NM_014661) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Top Pan Balance - 2200gm
LB2202C-1NO 1 unit

Top Pan Balance - 2200gm

Sign In for Pricing
View Details
KCNIP4 (NM_147182) Human Tagged Lenti ORF Clone
RC216528L3 10 µg

KCNIP4 (NM_147182) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ZNF154 3'UTR Lenti-reporter-Luc Vector
51317081 1.0 µg

ZNF154 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Olfr187 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4175502 1.0 µg DNA

Olfr187 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details