Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free AGER, Human (His)

AGER proteins are cell surface pattern recognition receptors that expertly sense endogenous stress signals utilizing an extensive library of ligands, including advanced glycation end products, S100 proteins, high mobility Group Box 1 proteins/HMGB1, starch Like protein β/APP oligomers, nucleic acids, phospholipids, and glycosaminoglycans. Animal-Free AGER Protein, Human (His) is the recombinant human-derived animal-FreeAGER protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free AGER Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ager-protein-human-his.html

Purity

95.00

Smiles

MAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYS

Molecular Formula

177 (Gene_ID) Q15109 (A23-S300) (Accession)

Molecular Weight

Approximately 30.94 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCST2 3'UTR Luciferase Stable Cell Line
TU005634 1.0 mL

DCST2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Human N-terminal C-Type Natriuretic Propeptid,NT-PROCNP ELISA KIT
JOT-EK6852Hu 96 wells

Human N-terminal C-Type Natriuretic Propeptid,NT-PROCNP ELISA KIT

Sign In for Pricing
View Details
PPAR delta Immunizing Peptide
MBS425164-01 0.1 mg

PPAR delta Immunizing Peptide

Sign In for Pricing
View Details
PPAR delta Immunizing Peptide
MBS425164-02 5x 0.1 mg

PPAR delta Immunizing Peptide

Sign In for Pricing
View Details
BMP2, Human
LF-P0389 10 ug

BMP2, Human

Sign In for Pricing
View Details
pOTB7-FOXRED1 Plasmid
PVT28848 2 µg

pOTB7-FOXRED1 Plasmid

Sign In for Pricing
View Details