Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free AGER, Human (His)

AGER proteins are cell surface pattern recognition receptors that expertly sense endogenous stress signals utilizing an extensive library of ligands, including advanced glycation end products, S100 proteins, high mobility Group Box 1 proteins/HMGB1, starch Like protein β/APP oligomers, nucleic acids, phospholipids, and glycosaminoglycans. Animal-Free AGER Protein, Human (His) is the recombinant human-derived animal-FreeAGER protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free AGER Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ager-protein-human-his.html

Purity

95.00

Smiles

MAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYS

Molecular Formula

177 (Gene_ID) Q15109 (A23-S300) (Accession)

Molecular Weight

Approximately 30.94 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse IL1b protein, N-His Tag, BSA Conjugated
IMP-2851 10 µg

Recombinant Mouse IL1b protein, N-His Tag, BSA Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal SgK071 Antibody
NBP1-55182 100 µL

Rabbit Polyclonal SgK071 Antibody

Sign In for Pricing
View Details
LHX8 Rabbit pAb
E45R24573N-100 100 µL

LHX8 Rabbit pAb

Sign In for Pricing
View Details
Fam136a sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4038103 1.0 µg DNA

Fam136a sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Rabbit Polyclonal CCDC91 Antibody [Janelia Fluor 549]
NBP2-98667JF549 0.1 mL

Rabbit Polyclonal CCDC91 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
HSPC302 (TBCK) (NM_001163435) Human Tagged ORF Clone
RG228610 10 µg

HSPC302 (TBCK) (NM_001163435) Human Tagged ORF Clone

Sign In for Pricing
View Details