Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free AGER, Human (His)

AGER proteins are cell surface pattern recognition receptors that expertly sense endogenous stress signals utilizing an extensive library of ligands, including advanced glycation end products, S100 proteins, high mobility Group Box 1 proteins/HMGB1, starch Like protein β/APP oligomers, nucleic acids, phospholipids, and glycosaminoglycans. Animal-Free AGER Protein, Human (His) is the recombinant human-derived animal-FreeAGER protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free AGER Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ager-protein-human-his.html

Purity

95.00

Smiles

MAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYS

Molecular Formula

177 (Gene_ID) Q15109 (A23-S300) (Accession)

Molecular Weight

Approximately 30.94 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Imported Irregular C18, 40-63μm,60Å, 5.9g
12011233 2 PCS

Imported Irregular C18, 40-63μm,60Å, 5.9g

Sign In for Pricing
View Details
Fip1l1 (NM_001159574) Mouse Tagged ORF Clone Lentiviral Particle
MR218745L3V 200 µL

Fip1l1 (NM_001159574) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
RN5S148 ORF Vector (Human) (pORF)
ORF029032 1.0 µg DNA

RN5S148 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS558482 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Rabbit Polyclonal PCIF1 Antibody
NBP3-29865 100 µg

Rabbit Polyclonal PCIF1 Antibody

Sign In for Pricing
View Details
NEFL ORF Vector (Human) (pORF)
ORF007015 1.0 µg DNA

NEFL ORF Vector (Human) (pORF)

Sign In for Pricing
View Details