Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free AGER, Human (His)

AGER proteins are cell surface pattern recognition receptors that expertly sense endogenous stress signals utilizing an extensive library of ligands, including advanced glycation end products, S100 proteins, high mobility Group Box 1 proteins/HMGB1, starch Like protein β/APP oligomers, nucleic acids, phospholipids, and glycosaminoglycans. Animal-Free AGER Protein, Human (His) is the recombinant human-derived animal-FreeAGER protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free AGER Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ager-protein-human-his.html

Purity

95.00

Smiles

MAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYS

Molecular Formula

177 (Gene_ID) Q15109 (A23-S300) (Accession)

Molecular Weight

Approximately 30.94 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Oit3 shRNA (UAS) - Lentiviral mouse Oit3 shRNA (UAS) (25)
GTR15298220 1 Vial

Lentiviral mouse Oit3 shRNA (UAS) - Lentiviral mouse Oit3 shRNA (UAS) (25)

Sign In for Pricing
View Details
Mouse Arg2 (Arginase II) ELISA Kit
EK246746 96 Well

Mouse Arg2 (Arginase II) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human DHRS1, His-tagged
DHRS1-11971H 25 µg

Recombinant Human DHRS1, His-tagged

Sign In for Pricing
View Details
MARCO (Macrophage Receptor MARCO, Macrophage Receptor with Collagenous Structure, AI323439, Ly112, Scara2) (MaxLight 490)
M2378-02E-ML490 100 µL

MARCO (Macrophage Receptor MARCO, Macrophage Receptor with Collagenous Structure, AI323439, Ly112, Scara2) (MaxLight 490)

Sign In for Pricing
View Details
Rat Wingless Type MMTV Integration Site Family, Member 3 (WNT3) ELISA Kit
RDR-WNT3-Ra-48Tests 48 Tests

Rat Wingless Type MMTV Integration Site Family, Member 3 (WNT3) ELISA Kit

Sign In for Pricing
View Details
Rat St8sia2 ELISA Kit
ELI-18665r 96 Tests

Rat St8sia2 ELISA Kit

Sign In for Pricing
View Details