Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free AGER, Human (His)

AGER proteins are cell surface pattern recognition receptors that expertly sense endogenous stress signals utilizing an extensive library of ligands, including advanced glycation end products, S100 proteins, high mobility Group Box 1 proteins/HMGB1, starch Like protein β/APP oligomers, nucleic acids, phospholipids, and glycosaminoglycans. Animal-Free AGER Protein, Human (His) is the recombinant human-derived animal-FreeAGER protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free AGER Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ager-protein-human-his.html

Purity

95.00

Smiles

MAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYS

Molecular Formula

177 (Gene_ID) Q15109 (A23-S300) (Accession)

Molecular Weight

Approximately 30.94 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDCP1 Antibody - C-terminal region
MBS3219419-01 0.1 mL

CDCP1 Antibody - C-terminal region

Sign In for Pricing
View Details
CDCP1 Antibody - C-terminal region
MBS3219419-02 5x 0.1 mL

CDCP1 Antibody - C-terminal region

Sign In for Pricing
View Details
Human TFF1 shRNA Plasmid
abx954805-01 150 µg

Human TFF1 shRNA Plasmid

Sign In for Pricing
View Details
Human TFF1 shRNA Plasmid
abx954805-02 300 µg

Human TFF1 shRNA Plasmid

Sign In for Pricing
View Details
Human FLT1 Knockout HEK293T cell line
GTR15413429 1 Vial

Human FLT1 Knockout HEK293T cell line

Sign In for Pricing
View Details
Nucleic acid hybridization rinse (low tension)
RARP052 500 mL

Nucleic acid hybridization rinse (low tension)

Sign In for Pricing
View Details