Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free AGER, Human (His)

AGER proteins are cell surface pattern recognition receptors that expertly sense endogenous stress signals utilizing an extensive library of ligands, including advanced glycation end products, S100 proteins, high mobility Group Box 1 proteins/HMGB1, starch Like protein β/APP oligomers, nucleic acids, phospholipids, and glycosaminoglycans. Animal-Free AGER Protein, Human (His) is the recombinant human-derived animal-FreeAGER protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free AGER Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ager-protein-human-his.html

Purity

95.00

Smiles

MAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYS

Molecular Formula

177 (Gene_ID) Q15109 (A23-S300) (Accession)

Molecular Weight

Approximately 30.94 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PDGF-DD PicoKine ELISA Kit
MBS1751605-01 96 Well

Human PDGF-DD PicoKine ELISA Kit

Sign In for Pricing
View Details
Human PDGF-DD PicoKine ELISA Kit
MBS1751605-02 5x 96 Well

Human PDGF-DD PicoKine ELISA Kit

Sign In for Pricing
View Details
SLCO6A1 (Solute Carrier Organic Anion Transporter Family Member 6A1, Cancer/Testis Antigen 48, CT48, Gonad-specific Transporter, GST, Organic Anion-transporting Polypeptide 6A1, Organic Anion-transporting Polypeptide I, OATP-I, Solute Carrier Family 21 Member 19, OATP6A1, SLC21A19, MGC26949) (MaxLight 750) discontinued
138385-ML750 100 µL

SLCO6A1 (Solute Carrier Organic Anion Transporter Family Member 6A1, Cancer/Testis Antigen 48, CT48, Gonad-specific Transporter, GST, Organic Anion-transporting Polypeptide 6A1, Organic Anion-transporting Polypeptide I, OATP-I, Solute Carrier Family 21 Member 19, OATP6A1, SLC21A19, MGC26949) (MaxLight 750) discontinued

Sign In for Pricing
View Details
SH3BGRL2 (NM_031469) Human Mass Spec Standard
PH306241 10 µg

SH3BGRL2 (NM_031469) Human Mass Spec Standard

Sign In for Pricing
View Details
Rabbit Anti-Human SRSF6 pAb
PA8229-01 50 μL

Rabbit Anti-Human SRSF6 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human SRSF6 pAb
PA8229-02 100 μL

Rabbit Anti-Human SRSF6 pAb

Sign In for Pricing
View Details