Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free AGER, Human (His)

AGER proteins are cell surface pattern recognition receptors that expertly sense endogenous stress signals utilizing an extensive library of ligands, including advanced glycation end products, S100 proteins, high mobility Group Box 1 proteins/HMGB1, starch Like protein β/APP oligomers, nucleic acids, phospholipids, and glycosaminoglycans. Animal-Free AGER Protein, Human (His) is the recombinant human-derived animal-FreeAGER protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free AGER Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ager-protein-human-his.html

Purity

95.00

Smiles

MAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYS

Molecular Formula

177 (Gene_ID) Q15109 (A23-S300) (Accession)

Molecular Weight

Approximately 30.94 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNX18 Protein Vector (Human) (pPM-C-His)
PV058188 500 ng

SNX18 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Human Ankyrin repeat and SOCS box protein 17, ASB17 ELISA KIT
ELI-34769h 96 Tests

Human Ankyrin repeat and SOCS box protein 17, ASB17 ELISA KIT

Sign In for Pricing
View Details
NKG2A (KLRC1) (NM_002259) Human Tagged ORF Clone
RC208585 10 µg

NKG2A (KLRC1) (NM_002259) Human Tagged ORF Clone

Sign In for Pricing
View Details
Canine Copeptin,CPP ELISA KIT
JOT-EK0419Ca 96 wells

Canine Copeptin,CPP ELISA KIT

Sign In for Pricing
View Details
ATAD1 (NM_032810) Human Recombinant Protein
TP762459 50 µg

ATAD1 (NM_032810) Human Recombinant Protein

Sign In for Pricing
View Details
Aifm3 sgRNA CRISPR Lentivector set (Mouse)
K3561901 3x 1.0 µg

Aifm3 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details