Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free AGER, Human (His)

AGER proteins are cell surface pattern recognition receptors that expertly sense endogenous stress signals utilizing an extensive library of ligands, including advanced glycation end products, S100 proteins, high mobility Group Box 1 proteins/HMGB1, starch Like protein β/APP oligomers, nucleic acids, phospholipids, and glycosaminoglycans. Animal-Free AGER Protein, Human (His) is the recombinant human-derived animal-FreeAGER protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free AGER Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ager-protein-human-his.html

Purity

95.00

Smiles

MAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYS

Molecular Formula

177 (Gene_ID) Q15109 (A23-S300) (Accession)

Molecular Weight

Approximately 30.94 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

S10AD rabbit pAb
ES10062-01 50 µL

S10AD rabbit pAb

Sign In for Pricing
View Details
S10AD rabbit pAb
ES10062-02 100 µL

S10AD rabbit pAb

Sign In for Pricing
View Details
UBE3B Antibody (YA8643, Mouse)
HY-P88959 1 Each

UBE3B Antibody (YA8643, Mouse)

Sign In for Pricing
View Details
HKT1 Antibody
PHY0979A 150 μg

HKT1 Antibody

Sign In for Pricing
View Details
KRT26 Protein Vector (Rat) (pPB-N-His)
PV276803 500 ng

KRT26 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Kallikrein 1 (KLK1)
MBS2162662-01 0.01 mg

Recombinant Kallikrein 1 (KLK1)

Sign In for Pricing
View Details