Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free AGER, Human (His)

AGER proteins are cell surface pattern recognition receptors that expertly sense endogenous stress signals utilizing an extensive library of ligands, including advanced glycation end products, S100 proteins, high mobility Group Box 1 proteins/HMGB1, starch Like protein β/APP oligomers, nucleic acids, phospholipids, and glycosaminoglycans. Animal-Free AGER Protein, Human (His) is the recombinant human-derived animal-FreeAGER protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free AGER Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ager-protein-human-his.html

Purity

95.00

Smiles

MAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYS

Molecular Formula

177 (Gene_ID) Q15109 (A23-S300) (Accession)

Molecular Weight

Approximately 30.94 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dog IgG2 Antibody
GWB-A53F35 0.25 mg

Dog IgG2 Antibody

Sign In for Pricing
View Details
RPS2P28 sgRNA CRISPR Lentivector set (Human)
K2001801 3x 1.0 µg

RPS2P28 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Slc4a2 ORF Vector (Mouse) (pORF)
44220015 1.0 µg DNA

Slc4a2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
MRPS14 sgRNA CRISPR Lentivector (Human) (Target 1)
K1334102 1.0 µg DNA

MRPS14 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
LHX3 (NM_014564) Human Over-expression Lysate
LC415201 20 µg

LHX3 (NM_014564) Human Over-expression Lysate

Sign In for Pricing
View Details
NEURL2 Human shRNA Plasmid Kit (Locus ID 140825)
TL317890 1 Kit

NEURL2 Human shRNA Plasmid Kit (Locus ID 140825)

Sign In for Pricing
View Details