Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free AGER, Human (His)

AGER proteins are cell surface pattern recognition receptors that expertly sense endogenous stress signals utilizing an extensive library of ligands, including advanced glycation end products, S100 proteins, high mobility Group Box 1 proteins/HMGB1, starch Like protein β/APP oligomers, nucleic acids, phospholipids, and glycosaminoglycans. Animal-Free AGER Protein, Human (His) is the recombinant human-derived animal-FreeAGER protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free AGER Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ager-protein-human-his.html

Purity

95.00

Smiles

MAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYS

Molecular Formula

177 (Gene_ID) Q15109 (A23-S300) (Accession)

Molecular Weight

Approximately 30.94 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytohesin 3 (CYTH3) (NM_004227) Human Tagged ORF Clone
RC206003 10 µg

Cytohesin 3 (CYTH3) (NM_004227) Human Tagged ORF Clone

Sign In for Pricing
View Details
A-Raf Rabbit Polyclonal Antibody
E53P02079 100 µL

A-Raf Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GCGR sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0846607 1.0 µg DNA

GCGR sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Tfdp2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6475905 3x 1.0 µg

Tfdp2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Pigeon Soluble L-Selectin (SLS) ELISA Kit
MBS9398706 Inquire

Pigeon Soluble L-Selectin (SLS) ELISA Kit

Sign In for Pricing
View Details
ACRP30 (Adipocyte Complement-related Protein of 30kD, Adiponectin, 30kD Adipocyte Complement-related Protein, Adipocyte, C1q and Collagen Domain-containing Protein, Adipose Most Abundant Gene Transcript 1 Protein, AdipoQ, apM1, Gelatin Binding Protein 28, GPB28, ACDC)
A0725-02T 100 µg

ACRP30 (Adipocyte Complement-related Protein of 30kD, Adiponectin, 30kD Adipocyte Complement-related Protein, Adipocyte, C1q and Collagen Domain-containing Protein, Adipose Most Abundant Gene Transcript 1 Protein, AdipoQ, apM1, Gelatin Binding Protein 28, GPB28, ACDC)

Sign In for Pricing
View Details