Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free AGER, Human (His)

AGER proteins are cell surface pattern recognition receptors that expertly sense endogenous stress signals utilizing an extensive library of ligands, including advanced glycation end products, S100 proteins, high mobility Group Box 1 proteins/HMGB1, starch Like protein β/APP oligomers, nucleic acids, phospholipids, and glycosaminoglycans. Animal-Free AGER Protein, Human (His) is the recombinant human-derived animal-FreeAGER protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free AGER Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ager-protein-human-his.html

Purity

95.00

Smiles

MAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYS

Molecular Formula

177 (Gene_ID) Q15109 (A23-S300) (Accession)

Molecular Weight

Approximately 30.94 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPHP4 Polyclonal Antibody
E55A03542 100 µg

NPHP4 Polyclonal Antibody

Sign In for Pricing
View Details
BGN Protein Vector (Rat) (pPM-C-HA)
PV256204 500 ng

BGN Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Activated coagulation Factor X (F10a) Human ELISA Kit
B2407 96 Tests

Activated coagulation Factor X (F10a) Human ELISA Kit

Sign In for Pricing
View Details
PP2Cε siRNA (h)
sc-78298 10 µM

PP2Cε siRNA (h)

Sign In for Pricing
View Details
Mouse Monoclonal GLMN Antibody (1C12)
H00011146-M01 0.1 mg

Mouse Monoclonal GLMN Antibody (1C12)

Sign In for Pricing
View Details
Rabbit Polyclonal NPY2R Antibody
NBP3-12479 100 µg

Rabbit Polyclonal NPY2R Antibody

Sign In for Pricing
View Details