Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free AGER, Human (His)

AGER proteins are cell surface pattern recognition receptors that expertly sense endogenous stress signals utilizing an extensive library of ligands, including advanced glycation end products, S100 proteins, high mobility Group Box 1 proteins/HMGB1, starch Like protein β/APP oligomers, nucleic acids, phospholipids, and glycosaminoglycans. Animal-Free AGER Protein, Human (His) is the recombinant human-derived animal-FreeAGER protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free AGER Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ager-protein-human-his.html

Purity

95.00

Smiles

MAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYS

Molecular Formula

177 (Gene_ID) Q15109 (A23-S300) (Accession)

Molecular Weight

Approximately 30.94 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,6-Anhydro-2-O-β-D-glucopyranosyl-β-D-glucopyranose
GC8470-10mg 10 mg

1,6-Anhydro-2-O-β-D-glucopyranosyl-β-D-glucopyranose

Sign In for Pricing
View Details
FGF21 Mouse Monoclonal Antibody [Clone ID: OTI2F8]
TA502868 100 µL

FGF21 Mouse Monoclonal Antibody [Clone ID: OTI2F8]

Sign In for Pricing
View Details
Human TAX1BP3 qPCR Primer Pair
QH39837S 200 Tests

Human TAX1BP3 qPCR Primer Pair

Sign In for Pricing
View Details
IL2 Receptor gamma (IL2RG) (Center) rabbit polyclonal antibody, Purified
AP52196PU-N 400 µL

IL2 Receptor gamma (IL2RG) (Center) rabbit polyclonal antibody, Purified

Sign In for Pricing
View Details
Human Galectin 2 (LGALS2) Protein
abx066729-01 10 µg

Human Galectin 2 (LGALS2) Protein

Sign In for Pricing
View Details
Human Galectin 2 (LGALS2) Protein
abx066729-02 50 µg

Human Galectin 2 (LGALS2) Protein

Sign In for Pricing
View Details