Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free AGER, Human (His)

AGER proteins are cell surface pattern recognition receptors that expertly sense endogenous stress signals utilizing an extensive library of ligands, including advanced glycation end products, S100 proteins, high mobility Group Box 1 proteins/HMGB1, starch Like protein β/APP oligomers, nucleic acids, phospholipids, and glycosaminoglycans. Animal-Free AGER Protein, Human (His) is the recombinant human-derived animal-FreeAGER protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free AGER Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ager-protein-human-his.html

Purity

95.00

Smiles

MAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYS

Molecular Formula

177 (Gene_ID) Q15109 (A23-S300) (Accession)

Molecular Weight

Approximately 30.94 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MPXV A42R / Profilin Polyclonal Antibody
ANT-13277-100ug 100 µg

MPXV A42R / Profilin Polyclonal Antibody

Sign In for Pricing
View Details
Alpha Tubulin Monoclonal Antibody, PerCP-Cy5.5 Conjugated
bsm-33039M-PerCP-Cy5.5 100 µL

Alpha Tubulin Monoclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
Anti HIV p27 Pab Rat
163087 100 µg

Anti HIV p27 Pab Rat

Sign In for Pricing
View Details
Recombinant Human CD27 Protein, His-tagged, FITC conjugated
CD27-556HF 20 μg- 50 μg- 100 μg

Recombinant Human CD27 Protein, His-tagged, FITC conjugated

Sign In for Pricing
View Details
TRNAN20 sgRNA CRISPR Lentivector (Human) (Target 3)
K2508404 1.0 µg DNA

TRNAN20 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Cyclosporin A (Antibiotic S 7481F1, Ciclosporin A, Ramihyphin A, CsA) (FITC) discontinued
C8900-01-FITC 100 µL

Cyclosporin A (Antibiotic S 7481F1, Ciclosporin A, Ramihyphin A, CsA) (FITC) discontinued

Sign In for Pricing
View Details