Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free AGER, Human (His)

AGER proteins are cell surface pattern recognition receptors that expertly sense endogenous stress signals utilizing an extensive library of ligands, including advanced glycation end products, S100 proteins, high mobility Group Box 1 proteins/HMGB1, starch Like protein β/APP oligomers, nucleic acids, phospholipids, and glycosaminoglycans. Animal-Free AGER Protein, Human (His) is the recombinant human-derived animal-FreeAGER protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free AGER Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ager-protein-human-his.html

Purity

95.00

Smiles

MAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYS

Molecular Formula

177 (Gene_ID) Q15109 (A23-S300) (Accession)

Molecular Weight

Approximately 30.94 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase-2 Fluorometric BioAssayTM Kit discontinued
219553 200 Tests

Caspase-2 Fluorometric BioAssayTM Kit discontinued

Sign In for Pricing
View Details
Recombinant Human Lysine Hydroxylase 2/PLOD2 Protein - (Dry Ice)
H00005352-P01-25ug 25 µg

Recombinant Human Lysine Hydroxylase 2/PLOD2 Protein - (Dry Ice)

Sign In for Pricing
View Details
ATG4B (ATG4B, APG4B, AUTL1, KIAA0943, Cysteine protease ATG4B, AUT-like 1 cysteine endopeptidase, Autophagin-1, Autophagy-related cysteine endopeptidase 1, Autophagy-related protein 4 homolog B) (HRP) discontinued
030791-HRP 100 µL

ATG4B (ATG4B, APG4B, AUTL1, KIAA0943, Cysteine protease ATG4B, AUT-like 1 cysteine endopeptidase, Autophagin-1, Autophagy-related cysteine endopeptidase 1, Autophagy-related protein 4 homolog B) (HRP) discontinued

Sign In for Pricing
View Details
Parotid Tissue Slides (Tumor) - (Dry Ice)
NBP2-77643 5 Slides

Parotid Tissue Slides (Tumor) - (Dry Ice)

Sign In for Pricing
View Details
Anti-SRSF1/SF2 Antibody (2D188)
MF-0089714-01 25 µL

Anti-SRSF1/SF2 Antibody (2D188)

Sign In for Pricing
View Details
Anti-SRSF1/SF2 Antibody (2D188)
MF-0089714-02 50 µL

Anti-SRSF1/SF2 Antibody (2D188)

Sign In for Pricing
View Details