Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free AGER, Human (His)

AGER proteins are cell surface pattern recognition receptors that expertly sense endogenous stress signals utilizing an extensive library of ligands, including advanced glycation end products, S100 proteins, high mobility Group Box 1 proteins/HMGB1, starch Like protein β/APP oligomers, nucleic acids, phospholipids, and glycosaminoglycans. Animal-Free AGER Protein, Human (His) is the recombinant human-derived animal-FreeAGER protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free AGER Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ager-protein-human-his.html

Purity

95.00

Smiles

MAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYS

Molecular Formula

177 (Gene_ID) Q15109 (A23-S300) (Accession)

Molecular Weight

Approximately 30.94 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-RGL2 antibody
STJ191247 200 µl

Anti-RGL2 antibody

Sign In for Pricing
View Details
AMH (NM_000479) Human Tagged ORF Clone Lentiviral Particle
RC208397L2V 200 µL

AMH (NM_000479) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti-CTBP2 antibody
PAab02047 100 µg

Anti-CTBP2 antibody

Sign In for Pricing
View Details
Recombinant Human CXXC5 protein, His-tagged
CXXC5-3523H 25 µg

Recombinant Human CXXC5 protein, His-tagged

Sign In for Pricing
View Details
ADORA2B Rabbit pAb (APR24493N)
APR24493N-01 50 µL

ADORA2B Rabbit pAb (APR24493N)

Sign In for Pricing
View Details
ADORA2B Rabbit pAb (APR24493N)
APR24493N-02 100 µL

ADORA2B Rabbit pAb (APR24493N)

Sign In for Pricing
View Details