Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free AGER, Human (His)

AGER proteins are cell surface pattern recognition receptors that expertly sense endogenous stress signals utilizing an extensive library of ligands, including advanced glycation end products, S100 proteins, high mobility Group Box 1 proteins/HMGB1, starch Like protein β/APP oligomers, nucleic acids, phospholipids, and glycosaminoglycans. Animal-Free AGER Protein, Human (His) is the recombinant human-derived animal-FreeAGER protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free AGER Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ager-protein-human-his.html

Purity

95.00

Smiles

MAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYS

Molecular Formula

177 (Gene_ID) Q15109 (A23-S300) (Accession)

Molecular Weight

Approximately 30.94 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine IL31RA Protein, mFc Tag
32-18518-100 100 µg

Canine IL31RA Protein, mFc Tag

Sign In for Pricing
View Details
LINC00313 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV701132 1.0 µg DNA

LINC00313 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
PMS2 (PMS2 Postmeiotic Segregation Increased 2 (S. cerevisiae), HNPCC4, PMS2CL, PMSL2)
250249 50 µL

PMS2 (PMS2 Postmeiotic Segregation Increased 2 (S. cerevisiae), HNPCC4, PMS2CL, PMSL2)

Sign In for Pricing
View Details
Mouse Monoclonal APC Antibody (Ali 12-28) [mFluor Violet 450 SE]
NB100-667MFV450 0.1 mL

Mouse Monoclonal APC Antibody (Ali 12-28) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Rat Apolipoprotein B/ApoB ELISA Kit (Colorimetric)
NBP2-82121 1 Kit

Rat Apolipoprotein B/ApoB ELISA Kit (Colorimetric)

Sign In for Pricing
View Details
HIST1H3A (Ab-28) Antibody
A25037-50UL 50 μL

HIST1H3A (Ab-28) Antibody

Sign In for Pricing
View Details