Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tumor necrosis factor receptor superfamily member 3 (Ltbr), partial

Product Specifications

Product Name Alternative

Lymphotoxin-beta receptor

Abbreviation

Recombinant Mouse Ltbr protein, partial

Gene Name

Ltbr

UniProt

P50284

Expression Region

31-223aa

Organism

Mus musculus (Mouse)

Target Sequence

QLVPPYRIENQTCWDQDKEYYEPMHDVCCSRCPPGEFVFAVCSRSQDTVCKTCPHNSYNEHWNHLSTCQLCRPCDIVLGFEEVAPCTSDRKAECRCQPGMSCVYLDNECVHCEEERLVLCQPGTEAEVTDEIMDTDVNCVPCKPGHFQNTSSPRARCQPHTRCEIQGLVEAAPGTSYSDTICKNPPEPGAMLL

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. Promotes apoptosis via TRAF3 and TRAF5. May play a role in the development of lymphoid organs.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

28.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM7, NT (TRIM7, GNIP, RNF90, Tripartite motif-containing protein 7, Glycogenin-interacting protein, RING finger protein 90) (FITC) discontinued
043262-FITC 200 µL

TRIM7, NT (TRIM7, GNIP, RNF90, Tripartite motif-containing protein 7, Glycogenin-interacting protein, RING finger protein 90) (FITC) discontinued

Sign In for Pricing
View Details
Anti-Human CD29 Monoclonal Antibody (APC Conjugated)
MBS2556469-01 20 Tests

Anti-Human CD29 Monoclonal Antibody (APC Conjugated)

Sign In for Pricing
View Details
Anti-Human CD29 Monoclonal Antibody (APC Conjugated)
MBS2556469-02 100 Tests

Anti-Human CD29 Monoclonal Antibody (APC Conjugated)

Sign In for Pricing
View Details
Anti-Human CD29 Monoclonal Antibody (APC Conjugated)
MBS2556469-03 2x 100 Tests

Anti-Human CD29 Monoclonal Antibody (APC Conjugated)

Sign In for Pricing
View Details
Anti-Human CD29 Monoclonal Antibody (APC Conjugated)
MBS2556469-04 10x 100 Tests

Anti-Human CD29 Monoclonal Antibody (APC Conjugated)

Sign In for Pricing
View Details
Anti-Brucella O-antigen Antibody (4F9)
JN879043-01 50 µg

Anti-Brucella O-antigen Antibody (4F9)

Sign In for Pricing
View Details