Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cathepsin W (Ctsw)

Product Specifications

Product Name Alternative

CtswCathepsin W; EC 3.4.22.-; Lymphopain

Abbreviation

Recombinant Mouse Ctsw protein

Gene Name

Ctsw

UniProt

P56203

Expression Region

126-371aa

Organism

Mus musculus (Mouse)

Target Sequence

VPRTCDWRKAKNIISSVKNQGSCKCCWAMAAADNIQALWRIKHQQFVDVSVQELLDCERCGNGCNGGFVWDAYLTVLNNSGLASEKDYPFQGDRKPHRCLAKKYKKVAWIQDFTMLSNNEQAIAHYLAVHGPITVTINMKLLQHYQKGVIKATPSSCDPRQVDHSVLLVGFGKEKEGMQTGTVLSHSRKRRHSSPYWILKNSWGAHWGEKGYFRLYRGNNTCGVTKYPFTAQVDSPVKKARTSCPP

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

May have a specific function in the mechanism or regulation of T-cell cytolytic activity.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

35.2 kDa

References & Citations

"Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs." Okazaki Y., Furuno M., Kasukawa T., Adachi J., Bono H., Kondo S., Nikaido I., Osato N., Saito R., Suzuki H., Yamanaka I., Kiyosawa H., Yagi K., Tomaru Y., Hasegawa Y., Nogami A., Schonbach C., Gojobori T. Hayashizaki Y. Nature 420:563-573 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRM2 Human Recombinant Protein, Synthetic Nanodisc
TP721502M 100 µg

GRM2 Human Recombinant Protein, Synthetic Nanodisc

Sign In for Pricing
View Details
ANGPTL1 Mouse Monoclonal Antibody [Clone ID: OTI9E5]
CF806289 100 µg

ANGPTL1 Mouse Monoclonal Antibody [Clone ID: OTI9E5]

Sign In for Pricing
View Details
CTLA4 Antibody
KC-294-01 50 μL

CTLA4 Antibody

Sign In for Pricing
View Details
CTLA4 Antibody
KC-294-02 100 µL

CTLA4 Antibody

Sign In for Pricing
View Details
CTLA4 Antibody
KC-294-03 1 mL

CTLA4 Antibody

Sign In for Pricing
View Details
SRPR beta (SRPRB) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D4]
TA504724BM 100 µL

SRPR beta (SRPRB) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D4]

Sign In for Pricing
View Details