Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Myoglobin (MB)

Product Specifications

Abbreviation

Recombinant Bovine Myoglobin protein

Gene Name

MB

UniProt

P02192

Expression Region

2-154aa

Organism

Bos taurus (Bovine)

Target Sequence

GLSDGEWQLVLNAWGKVEADVAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASEDLKKHGNTVLTALGGILKKKGHHEAEVKHLAESHANKHKIPVKYLEFISDAIIHVLHAKHPSDFGADAQAAMSKALELFRNDMAAQYKVLGFHG

Tag

Tag-Free

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.6 kDa

References & Citations

"Characterization of the promoter region of the bovine SIX1 gene: Roles of MyoD, PAX7, CREB and MyoG." Wei D.W., Ma X.Y., Zhang S., Hong J.Y., Gui L.S., Mei C.G., Guo H.F., Wang L., Ning Y., Zan L.S. Sci Rep 7:12599-12599 (2017)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCM7 (Proliferation Marker) (rMCM7/1468), CF640R conjugate, 0.1mg/mL
BNC403195-100 1x 100 µL

MCM7 (Proliferation Marker) (rMCM7/1468), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human ESM1 Antibody Pair Set
E-KAB-0165 50 µL & 100 µg

Human ESM1 Antibody Pair Set

Sign In for Pricing
View Details
HnRNP U Antibody
KC-6108-01 50 μL

HnRNP U Antibody

Sign In for Pricing
View Details
HnRNP U Antibody
KC-6108-02 100 µL

HnRNP U Antibody

Sign In for Pricing
View Details
HnRNP U Antibody
KC-6108-03 1 mL

HnRNP U Antibody

Sign In for Pricing
View Details
16-Deacetyl Fusidic Acid Sodium Salt
TRC-D198950-5MG 5 mg

16-Deacetyl Fusidic Acid Sodium Salt

Sign In for Pricing
View Details