SDF-1 alpha/CXCL12, Rat
SDF-1 alpha (Stromal Cell-Derived Factor-1α, SDF-1α) is a member of the chemokine α subfamily that lack the ELR domain. SDF-1α works as a chemoattractant for T- and B-lymphocytes and monocytes. SDF-1α is a ligand for CXCR4. The SDF-1α/CXCR4 signaling mediates many physiological processes including cell trafficking, angiogenesis, embryogenesis, tumor invasion and metastatic. It also controls the chemotaxis of hematopoietic stem cells homing to the bone marrow[1][2]. SDF-1 alpha/CXCL12 Protein, Rat is produced in E. coli.
Product Specifications
Product Name Alternative
SDF-1 alpha/CXCL12 Protein, Rat, Rat, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/sdf-1-alpha-cxcl12-protein-rat.html
Purity
98.0
Smiles
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKSNNRQVCIDPKLKWIQEYLDKALNK
Molecular Formula
24772 (Gene_ID) Q9QZD1/Q80YV8 (K22-K89) (Accession)
Molecular Weight
Approximately 8 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL
CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL
Cytokeratin 8/18 (C-51), CF740 conjugate, 0.1mg/mL
