IFN-alpha 13/IFNA13, Mouse (HEK293, His)
IFN-alpha 13 (IFNA13), belongs to type I interferon family, is produced by macrophages with antiviral activities[1]. IFN-alpha 13/IFNA13 Protein, Mouse (HEK293, His) contains 189 a.a. (M1-E189), produced in HEK293 cells with a C-terminal His-tag.
Product Specifications
Product Name Alternative
IFN-alpha 13/IFNA13 Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ifn-alpha-13-ifna1-protein-mouse-hek293-his.html
Purity
95.20
Smiles
CDLPQTHNLRNKRALTLLEQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPFVHELTQQILTLFTSNDSSAAWNATLLDSFCNDLHQQLNDLKACLMQQVGVQEFPLTQEDSLLAVRKYFHSITVYLREKKHSPCAWEVVRAEVQRTLSSSANLLARLSKEE
Molecular Formula
230396 (Gene_ID) Q80SU4 (C24-E189) (Accession)
Molecular Weight
Approximately 20-31 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
References & Citations
[1]Kumagai Y, et al. Alveolar macrophages are the primary interferon-alpha producer in pulmonary infection with RNA viruses. Immunity. 2007 Aug;27 (2) :240-52.|[2]Zhang SY, et al. Inborn errors of interferon (IFN) -mediated immunity in humans: insights into the respective roles of IFN-alpha/beta, IFN-gamma, and IFN-lambda in host defense. Immunol Rev. 2008 Dec;226:29-40.|[3]Raj NB, et al. Identification of a novel virus-responsive sequence in the promoter of murine interferon-alpha genes. J Biol Chem. 1991 Jun 15;266 (17) :11360-5.|[4]van Pesch V, et al. Characterization of interferon-alpha 13, a novel constitutive murine interferon-alpha subtype. J Biol Chem. 2003 Nov 21;278 (47) :46321-8.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15389530 1 Vial
Lentiviral human TRPC5OS sgRNA gene knockout kit - Lentiviral human TRPC5OS sgRNA gene knockout kit (100)
Sign In for Pricing
View Details K0070802 1.0 µg DNA
ALDH1B1 sgRNA CRISPR Lentivector (Human) (Target 1)
Sign In for Pricing
View Details 