Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Siglec-15, Human (HEK293, mFc)

The Siglec-15 protein plays a critical role in cellular interactions, selectively binding to sialylated glycoproteins with affinity for sialic acid residues. Binding to TYROBP and HCST suggests involvement in complex signaling pathways. Siglec-15 Protein, Human (HEK293, mFc) is the recombinant human-derived Siglec-15 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

Siglec-15 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/siglec-15-protein-human-hek-293-mfc.html

Purity

95.0

Smiles

FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST

Molecular Formula

284266 (Gene_ID) Q6ZMC9-1 (F20-T263) (Accession)

Molecular Weight

50-70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RASSF5 (Ras Association (RalGDS/AF-6) Domain Family Member 5, MGC10823, MGC17344, Maxp1, NORE1, NORE1A, NORE1B, RAPL, RASSF3) (APC)
250910-APC 100 µL

RASSF5 (Ras Association (RalGDS/AF-6) Domain Family Member 5, MGC10823, MGC17344, Maxp1, NORE1, NORE1A, NORE1B, RAPL, RASSF3) (APC)

Sign In for Pricing
View Details
8430410K20Rik 3'UTR GFP Stable Cell Line
TU150975 1.0 mL

8430410K20Rik 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
STAR siRNA (Mouse)
MBS8200570-01 15 nmol

STAR siRNA (Mouse)

Sign In for Pricing
View Details
STAR siRNA (Mouse)
MBS8200570-02 30 nmol

STAR siRNA (Mouse)

Sign In for Pricing
View Details
STAR siRNA (Mouse)
MBS8200570-03 5x 30 nmol

STAR siRNA (Mouse)

Sign In for Pricing
View Details
Tubulin Beta-4A Chain (TUBB4A) Antibody
abx302623-01 20 µg

Tubulin Beta-4A Chain (TUBB4A) Antibody

Sign In for Pricing
View Details