Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Siglec-15, Human (HEK293, mFc)

The Siglec-15 protein plays a critical role in cellular interactions, selectively binding to sialylated glycoproteins with affinity for sialic acid residues. Binding to TYROBP and HCST suggests involvement in complex signaling pathways. Siglec-15 Protein, Human (HEK293, mFc) is the recombinant human-derived Siglec-15 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

Siglec-15 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/siglec-15-protein-human-hek-293-mfc.html

Purity

95.0

Smiles

FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST

Molecular Formula

284266 (Gene_ID) Q6ZMC9-1 (F20-T263) (Accession)

Molecular Weight

50-70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mettl9 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6749008 1.0 µg DNA

Mettl9 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
SLC22A8 sgRNA CRISPR Lentivector (Human) (Target 2)
K2172903 1.0 µg DNA

SLC22A8 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
ARSB Mouse Monoclonal Antibody [Clone ID: LBI6G9]
AMM20950VCF 100 µg

ARSB Mouse Monoclonal Antibody [Clone ID: LBI6G9]

Sign In for Pricing
View Details
CASP14 Protein Vector (Mouse) (pPB-N-His)
PV161683 500 ng

CASP14 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
BAIAP2L1 Antibody
MBS9509226-01 0.05 mL

BAIAP2L1 Antibody

Sign In for Pricing
View Details
BAIAP2L1 Antibody
MBS9509226-02 0.1 mL

BAIAP2L1 Antibody

Sign In for Pricing
View Details