Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Siglec-15, Human (HEK293, mFc)

The Siglec-15 protein plays a critical role in cellular interactions, selectively binding to sialylated glycoproteins with affinity for sialic acid residues. Binding to TYROBP and HCST suggests involvement in complex signaling pathways. Siglec-15 Protein, Human (HEK293, mFc) is the recombinant human-derived Siglec-15 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

Siglec-15 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/siglec-15-protein-human-hek-293-mfc.html

Purity

95.0

Smiles

FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST

Molecular Formula

284266 (Gene_ID) Q6ZMC9-1 (F20-T263) (Accession)

Molecular Weight

50-70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-H1X antibody
STJ190241 200 µl

Anti-H1X antibody

Sign In for Pricing
View Details
Campylobacter jejuni IgM ELISA Kit
ESR139M-1 96 Tests

Campylobacter jejuni IgM ELISA Kit

Sign In for Pricing
View Details
RPS3AP5-set siRNA/shRNA/RNAi Lentivector (Human)
42539091 4x 500 ng

RPS3AP5-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
BCL2L12 (BPR, Bcl-2-like Protein 12, Bcl-2-related Proline-rich Protein, MGC120313, MGC120314, MGC120315) (PE)
123886-PE 100 µL

BCL2L12 (BPR, Bcl-2-like Protein 12, Bcl-2-related Proline-rich Protein, MGC120313, MGC120314, MGC120315) (PE)

Sign In for Pricing
View Details
Rabbit anti-Rhizobium meliloti (strain 1021)(Ensifer meliloti)(Sinorhizobium meliloti) SUHR Polyclonal Antibody
MBS7153003 Inquire

Rabbit anti-Rhizobium meliloti (strain 1021)(Ensifer meliloti)(Sinorhizobium meliloti) SUHR Polyclonal Antibody

Sign In for Pricing
View Details
SFTPD/SP-D Protein (C-His, Human)
P518320 100 µg

SFTPD/SP-D Protein (C-His, Human)

Sign In for Pricing
View Details