Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Siglec-15, Human (HEK293, mFc)

The Siglec-15 protein plays a critical role in cellular interactions, selectively binding to sialylated glycoproteins with affinity for sialic acid residues. Binding to TYROBP and HCST suggests involvement in complex signaling pathways. Siglec-15 Protein, Human (HEK293, mFc) is the recombinant human-derived Siglec-15 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

Siglec-15 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/siglec-15-protein-human-hek-293-mfc.html

Purity

95.0

Smiles

FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST

Molecular Formula

284266 (Gene_ID) Q6ZMC9-1 (F20-T263) (Accession)

Molecular Weight

50-70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIAA0922 Recombinant Protein Antigen
NBP2-30789PEP 0.1 mL

KIAA0922 Recombinant Protein Antigen

Sign In for Pricing
View Details
mAb anti-human PSMA
MBS592183-01 0.1 mg

mAb anti-human PSMA

Sign In for Pricing
View Details
mAb anti-human PSMA
MBS592183-02 0.5 mg

mAb anti-human PSMA

Sign In for Pricing
View Details
mAb anti-human PSMA
MBS592183-03 5x 0.5 mg

mAb anti-human PSMA

Sign In for Pricing
View Details
Rabbit Monoclonal Marapsin/Pancreasin Antibody (109) [Alexa Fluor 350]
NBP2-90057AF350 0.1 mL

Rabbit Monoclonal Marapsin/Pancreasin Antibody (109) [Alexa Fluor 350]

Sign In for Pricing
View Details
Mouse Monoclonal G-CSFR/CD114 Antibody (38643) [PE]
FAB3811P 0.5 mL

Mouse Monoclonal G-CSFR/CD114 Antibody (38643) [PE]

Sign In for Pricing
View Details