Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Siglec-15, Human (HEK293, mFc)

The Siglec-15 protein plays a critical role in cellular interactions, selectively binding to sialylated glycoproteins with affinity for sialic acid residues. Binding to TYROBP and HCST suggests involvement in complex signaling pathways. Siglec-15 Protein, Human (HEK293, mFc) is the recombinant human-derived Siglec-15 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

Siglec-15 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/siglec-15-protein-human-hek-293-mfc.html

Purity

95.0

Smiles

FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST

Molecular Formula

284266 (Gene_ID) Q6ZMC9-1 (F20-T263) (Accession)

Molecular Weight

50-70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli (strain K12) YPDJ Polyclonal Antibody
MBS7192626 Inquire

Rabbit anti-Escherichia coli (strain K12) YPDJ Polyclonal Antibody

Sign In for Pricing
View Details
rno-miR-326-5p miRNA Inhibitor
MBS8297673-01 10 nmol

rno-miR-326-5p miRNA Inhibitor

Sign In for Pricing
View Details
rno-miR-326-5p miRNA Inhibitor
MBS8297673-02 20 nmol

rno-miR-326-5p miRNA Inhibitor

Sign In for Pricing
View Details
rno-miR-326-5p miRNA Inhibitor
MBS8297673-03 5x 20 nmol

rno-miR-326-5p miRNA Inhibitor

Sign In for Pricing
View Details
Rabbit Polyclonal CHADL Antibody [DyLight 488]
NBP2-81906G 0.1 mL

Rabbit Polyclonal CHADL Antibody [DyLight 488]

Sign In for Pricing
View Details
Apolipoprotein E Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-61226R-BF594-01 20 µL

Apolipoprotein E Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details