Siglec-15, Human (HEK293, mFc)
The Siglec-15 protein plays a critical role in cellular interactions, selectively binding to sialylated glycoproteins with affinity for sialic acid residues. Binding to TYROBP and HCST suggests involvement in complex signaling pathways. Siglec-15 Protein, Human (HEK293, mFc) is the recombinant human-derived Siglec-15 protein, expressed by HEK293 , with C-mFc labeled tag.
Product Specifications
Product Name Alternative
Siglec-15 Protein, Human (HEK293, mFc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/siglec-15-protein-human-hek-293-mfc.html
Purity
95.0
Smiles
FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST
Molecular Formula
284266 (Gene_ID) Q6ZMC9-1 (F20-T263) (Accession)
Molecular Weight
50-70 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
410156-01 2.5 mg
1-Nitroso-1- (2-Hydroxyethyl) -3- (2-chloroethyl) urea-d4
Sign In for Pricing
View Details 
410156-02 5 mg
1-Nitroso-1- (2-Hydroxyethyl) -3- (2-chloroethyl) urea-d4
Sign In for Pricing
View Details 
abx256287-01 96 Tests
Rat N-Terminal Pro-Brain Natriuretic Peptide (NT-ProBNP) ELISA Kit
Sign In for Pricing
View Details abx256287-02 5x 96 Tests
Rat N-Terminal Pro-Brain Natriuretic Peptide (NT-ProBNP) ELISA Kit
Sign In for Pricing
View Details abx256287-03 10x 96 Tests
Rat N-Terminal Pro-Brain Natriuretic Peptide (NT-ProBNP) ELISA Kit
Sign In for Pricing
View Details MZIP26b-PA-1 Bacterial Streak
miRZip-26b anti-miR-26b microRNA construct
Sign In for Pricing
View Details