Siglec-15, Human (HEK293, mFc)
The Siglec-15 protein plays a critical role in cellular interactions, selectively binding to sialylated glycoproteins with affinity for sialic acid residues. Binding to TYROBP and HCST suggests involvement in complex signaling pathways. Siglec-15 Protein, Human (HEK293, mFc) is the recombinant human-derived Siglec-15 protein, expressed by HEK293 , with C-mFc labeled tag.
Product Specifications
Product Name Alternative
Siglec-15 Protein, Human (HEK293, mFc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/siglec-15-protein-human-hek-293-mfc.html
Purity
95.0
Smiles
FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST
Molecular Formula
284266 (Gene_ID) Q6ZMC9-1 (F20-T263) (Accession)
Molecular Weight
50-70 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
K2636002 1.0 µg DNA
WDR86 sgRNA CRISPR Lentivector (Human) (Target 1)
Sign In for Pricing
View Details K6180104 1.0 µg DNA
Stk19 sgRNA CRISPR Lentivector (Rat) (Target 3)
Sign In for Pricing
View Details 
43975111 3x 1.0 µg
SLC24A5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Sign In for Pricing
View Details 
AMM20043V 100 µL
CEP72 Mouse Monoclonal Antibody [Clone ID: LBI1A5]
Sign In for Pricing
View Details