Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Siglec-15, Human (HEK293, mFc)

The Siglec-15 protein plays a critical role in cellular interactions, selectively binding to sialylated glycoproteins with affinity for sialic acid residues. Binding to TYROBP and HCST suggests involvement in complex signaling pathways. Siglec-15 Protein, Human (HEK293, mFc) is the recombinant human-derived Siglec-15 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

Siglec-15 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/siglec-15-protein-human-hek-293-mfc.html

Purity

95.0

Smiles

FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST

Molecular Formula

284266 (Gene_ID) Q6ZMC9-1 (F20-T263) (Accession)

Molecular Weight

50-70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

INHA Rabbit pAb (APR23649N)
APR23649N-01 50 µL

INHA Rabbit pAb (APR23649N)

Sign In for Pricing
View Details
INHA Rabbit pAb (APR23649N)
APR23649N-02 100 µL

INHA Rabbit pAb (APR23649N)

Sign In for Pricing
View Details
INHA Rabbit pAb (APR23649N)
APR23649N-03 200 µL

INHA Rabbit pAb (APR23649N)

Sign In for Pricing
View Details
Lentiviral mouse Shroom4 shRNA (UAS) - Lentiviral mouse Shroom4 shRNA (UAS) (25)
GTR15242261 1 Vial

Lentiviral mouse Shroom4 shRNA (UAS) - Lentiviral mouse Shroom4 shRNA (UAS) (25)

Sign In for Pricing
View Details
Recombinant Candida glabrata Mitochondrial distribution and morphology protein 32 (MDM32), partial
MBS7087192 Inquire

Recombinant Candida glabrata Mitochondrial distribution and morphology protein 32 (MDM32), partial

Sign In for Pricing
View Details
KLHL12 Antibody
A57055-50UG 50 µg

KLHL12 Antibody

Sign In for Pricing
View Details