Siglec-15, Human (HEK293, mFc)
The Siglec-15 protein plays a critical role in cellular interactions, selectively binding to sialylated glycoproteins with affinity for sialic acid residues. Binding to TYROBP and HCST suggests involvement in complex signaling pathways. Siglec-15 Protein, Human (HEK293, mFc) is the recombinant human-derived Siglec-15 protein, expressed by HEK293 , with C-mFc labeled tag.
Product Specifications
Product Name Alternative
Siglec-15 Protein, Human (HEK293, mFc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/siglec-15-protein-human-hek-293-mfc.html
Purity
95.0
Smiles
FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST
Molecular Formula
284266 (Gene_ID) Q6ZMC9-1 (F20-T263) (Accession)
Molecular Weight
50-70 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC041820-500 1x 500 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC742853-500 1x 500 µL
CD54 / ICAM-1 (15.2), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470270-500 1x 500 µL
Fibronectin (HFN7.1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470009-500 1x 500 µL
MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740900-100 1x 100 µL
Granulocyte-Colony Stimulating Factor (G-CSF) (CSF3) (CSF3/900), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741387-500 1x 500 µL
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1387), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details