Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLGF, Mouse (HEK293, His)

PLGF protein is an important growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration by binding to the FLT1/VEGFR-1 receptor.PLGF plays a crucial role in angiogenesis and also contributes to tumor growth, highlighting its involvement in pathological angiogenesis.PLGF Protein, Mouse (HEK293, His) is the recombinant mouse-derived PLGF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PLGF Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/plgf-protein-mouse-hek-293-his.html

Purity

95.0

Smiles

VHSQGALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHP

Molecular Formula

18654 (Gene_ID) P49764 (V19-P158) (Accession)

Molecular Weight

Approximately 27-30 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Bax Antibody (BAX/8960R) [DyLight 650]
NBP3-23999C 0.1 mL

Rabbit Monoclonal Bax Antibody (BAX/8960R) [DyLight 650]

Sign In for Pricing
View Details
Ccndbp1-set siRNA/shRNA/RNAi Lentivector (Mouse)
15395094 4x 500 ng

Ccndbp1-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
C9orf57 Antibody; HRP conjugated
MBS7005283-01 0.05 mg

C9orf57 Antibody; HRP conjugated

Sign In for Pricing
View Details
C9orf57 Antibody; HRP conjugated
MBS7005283-02 0.1 mg

C9orf57 Antibody; HRP conjugated

Sign In for Pricing
View Details
C9orf57 Antibody; HRP conjugated
MBS7005283-03 5x 0.1 mg

C9orf57 Antibody; HRP conjugated

Sign In for Pricing
View Details
POLYART CHARTS, Teeth and Skin
4060150/6 1 Each

POLYART CHARTS, Teeth and Skin

Sign In for Pricing
View Details