Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRO-gamma/CXCL3, Human

CXCL3 is a chemoattractant for neutrophils and belongs to CXC chemokine subfamily. CXCL3 is a secreted growth factor that signals through its cognate receptor CXCR2. CXCL3 is involved in many immune responses including wound healing, cancer metastasis, and angiogenesis[1][2]. GRO-ganma/CXCL3 Protein, Human is produced in E. coli , and consists of 73 amino acids (A35-N107) .

Product Specifications

Product Name Alternative

GRO-gamma/CXCL3 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gro-gama-cxcl3-protein-human.html

Purity

97.00

Smiles

ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN

Molecular Formula

2921 (Gene_ID) P19876 (A35-N107) (Accession)

Molecular Weight

Approximately 7.9 kDa

References & Citations

[1]Niradiz Reyes, et al. CXCL3 Signaling in the Tumor Microenvironment. Adv Exp Med Biol. 2021;1302:15-24.|[2]Joji Kusuyama, et al. CXCL3 positively regulates adipogenic differentiation. J Lipid Res. 2016 Oct;57 (10) :1806-1820.|[3]Khushboo Gulati, et al. Molecular cloning and biophysical characterization of CXCL3 chemokine. Int J Biol Macromol. 2018 Feb;107 (Pt A) :575-584.|[4]Jinru Weng, et al. CXCL3 overexpression affects the malignant behavior of oral squamous cell carcinoma cells via the MAPK signaling pathway. J Oral Pathol Med. 2021 Oct;50 (9) :902-910.|[5]Laila A Al-Alwan, et al. Differential roles of CXCL2 and CXCL3 and their receptors in regulating normal and asthmatic airway smooth muscle cell migration. J Immunol. 2013 Sep 1;191 (5) :2731-41.|[6]Jian Guan, et al. Clinical significance and biological functions of chemokine CXCL3 in head and neck squamous cell carcinoma. Biosci Rep. 2021 Dec 22;41 (12) :BSR20212403.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CGMP-gated cation channel alpha-1 (CNGA1) Antibody (HRP)
abx341568-01 20 µg

CGMP-gated cation channel alpha-1 (CNGA1) Antibody (HRP)

Sign In for Pricing
View Details
CGMP-gated cation channel alpha-1 (CNGA1) Antibody (HRP)
abx341568-02 50 µg

CGMP-gated cation channel alpha-1 (CNGA1) Antibody (HRP)

Sign In for Pricing
View Details
CGMP-gated cation channel alpha-1 (CNGA1) Antibody (HRP)
abx341568-03 100 µg

CGMP-gated cation channel alpha-1 (CNGA1) Antibody (HRP)

Sign In for Pricing
View Details
CGMP-gated cation channel alpha-1 (CNGA1) Antibody (HRP)
abx341568-04 200 µg

CGMP-gated cation channel alpha-1 (CNGA1) Antibody (HRP)

Sign In for Pricing
View Details
CGMP-gated cation channel alpha-1 (CNGA1) Antibody (HRP)
abx341568-05 1 mg

CGMP-gated cation channel alpha-1 (CNGA1) Antibody (HRP)

Sign In for Pricing
View Details
AGXT2L2 Protein Vector (Rat) (pPM-C-His)
PV252789 500 ng

AGXT2L2 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details