Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD14, Cynomolgus (HEK293, His)

CD14 protein is a key coreceptor that cooperates with LBP to bind LPS and deliver it to the LY96/TLR4 complex to generate an immune response. CD14 activates NF-kappa-B through MyD88, TIRAP and TRAF6, triggering inflammation and cytokine release. CD14 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD14 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD14 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd14-protein-cynomolgus-hek293-his.html

Purity

97.00

Smiles

TTPEPCELDDEDFRCVCNFSEPHPDWSEAFQCVSAVEVEIRVGGLSLEPFLTRVDPDADPRQYADTIKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLQELTLEDLEITGTMPPLPLEATGLALSSLRLHNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLIAALCPHKFPALQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATANPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRRPRPDELPQVDNLALDGNPFLVPGTALPQEGSM

Molecular Formula

697482 (Gene_ID) B3Y6B8 (T20-M344) (Accession)

Molecular Weight

Approximately 45-56 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4930505A04Rik Protein Vector (Mouse) (pPB-C-His)
PV149238 500 ng

4930505A04Rik Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Rabbit Polyclonal ECT2 Antibody [Biotin]
NBP1-28729B 0.1 mL

Rabbit Polyclonal ECT2 Antibody [Biotin]

Sign In for Pricing
View Details
Magic™ Human TACR3 CHO-K1 Cell Line with Aequorin RepoRoom Temperatureer, Calcium flux assay
S01YF-1222-KX171 1 Vial

Magic™ Human TACR3 CHO-K1 Cell Line with Aequorin RepoRoom Temperatureer, Calcium flux assay

Sign In for Pricing
View Details
Hist1h1d (H1f3) (NM_145713) Mouse Tagged ORF Clone Lentiviral Particle
MR217111L4V 200 µL

Hist1h1d (H1f3) (NM_145713) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti-Erythrocyte Catalase (EC) Polyclonal antibody
FY-AB33520-01 1 mL

Anti-Erythrocyte Catalase (EC) Polyclonal antibody

Sign In for Pricing
View Details
Anti-Erythrocyte Catalase (EC) Polyclonal antibody
FY-AB33520-02 100 µL

Anti-Erythrocyte Catalase (EC) Polyclonal antibody

Sign In for Pricing
View Details